Identifiers and Description

Gene Model Identifier

TTHERM_00494570

Standard Name

PRP17 (Pre-mRNA-splicing factor PRP17)

Aliases

PreTt04285 | 61.m00272 | 3711.m00119

Description

Pre-mRNA-splicing factor

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF06994 ) Involucrin
  • ( PF00400 ) WD domain, G-beta repeat
  • ( PF09026 ) Centromere protein B dimerisation domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.6%

TetraMine Data

TTHERM_00494570

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13049.19.997093137033517e-262hypothetical protein (615 aa)
OxytrichaContig22582.0.g1052.999784173812224e-165WD domain, G-beta repeat
DictyBaseDDB_G02895011.0002323021920326e-132cdc40 on chromosome: 5 positio
n 2860682 to 2862469
WormBaseWBGene000186257.997988266401245e-108locus:prp-17 status:Confirme
d UniProt:O44729 protein_i
d:CCD71532.1
SGDYDR364C2.998543574353313e-72CDC40 Pre-mRNA splicing factor
, important for catalytic step
II of pre-mRNA splicing and p
lays a role in cell cycle prog
ression; required for DNA synt
hesis during mitosis and meios
is; has WD repeats
Stentor CoeruleusSteCoe_50043.1743585474772134e-60

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00494570(coding)
ATGATTGTCGATTATAGTGATAGCGATCCAGAACCAGAATTTTAAAAGAAAAGAGTAGAA
GAAAGCGCAAATAGCAAAAGTTTTGCTATTGCAGTAAATGTTAAACCTGATGTAAATACT
TCAAAGTTGGAGTAAGAAAGGGAAGAGAATAGATTAAGGTAGTTAAATTAGATTTACAAT
AGCGGAAATAGTGAATAAAATAAAAAAAACAATCATTTAACTGGCAAAGTAGAGAGCTAC
AATATGCATAGTTTTAGTTTTGACTAGCAATTTTATAATTTCAAGAATAGAGGCTATGCA
TATGATCCTTAGTTAGATGAAAATAGAATAGTTGTAAATGATGCTAAATTCCCAGAGCTT
GCTTAAGTTATTCATTATGGAGGAAATGTCGATCCTAATATGCTTGATACATAGGGAGCA
TTTATCTCACAAAGTAATGAAGAAAAATAAAAACAAAAGTAATTAAAAGCCTTGAGAGAA
AAAACAGGTGCTGTTACTGATGGTACTTATGCCGGTCCTTGGGCAAATTATCAAGGAGAA
AATATAAAACCAAAAGAATTAACTCAAGAAGAGAAATTAGAACTAGAAAAAAAGAAAATT
GAAGAATAGGAAGAAGCTAAGATTAAAAAAGAAAAGAAAAGAAAGTAAAAACTAAAAGAA
AAGGGCTTTGAAATAGATGATGATGAAGATTAAGAAAATGAAGGAAAAAAAGCTAAAGAT
AAAGAAGGAAACGAAGAGTAAGAATAAAAATAATTAGAAGGTGAAGGTTAACCTGAAGAA
GCTAAAAAATAAAAAGAAAAAAGCGAAGTAACAACGTCTATTTTTCACGATGCTGTACCT
TACTTTGATTATAAAGGTAGAAGCTACATATAACCTCCTATTGATTTAAAACCTAGAGAG
CATGTATGCTACATACCTAAAAAGTAAGTTCACTGCTGGTCAGGTCATGAAAAGGGAGTT
TAAGCTATTAGATTTTTCCCTAAATTTGGTCATTATTTGTTATCAGCATCTCTTGATACC
ACAGTAAAATTATGGGATGTAATGGGTAATAAGAAATGTGTAAGAACATATATGGGACAT
AAATAAGCTGTTAGAGATATTGAGTTTACTAATGATGGAAGACATTTCCTCTCTTGTTCT
TATGATAAAAATGTATTATATTGGGATACTGAGACTGGTAAAATTGTAAGAACTTTCAAT
ATTAAGAAGTACCCATACCAGGCAAGATTTAACCCAGACGAGGGTAAATAAAGCTCATTT
ATTCTTGCTTCTTCCAATAAAAAAGTGTTACAATACGATGTTAGATCTGGAGCAAGAACA
TAAGTTTATGATGAGCATTTAGGTGCAGTTAACACAGTTACTTTTGTTGACTATGGTAGA
AAATTTGTTTCTACTTCTGATGATAAAAAAATATTCTTGTGGGGCTTTGGTATAGGTGTC
GTCGAAAAGCATATTGCAGAACCAGATATGACAGCTGTTGCAAACACAAACATTCATCCT
ACAGAAAAGTTCTTTGCAGGCCAATGCTCAGATAATAAAATTTAAATTTATGATACTAAA
GGAGGTAACTTTAGACTTAACAAGAAAAAATTATTTAAAGAACACGTTTCTTCTGGTTAT
GCAATTGGTTTAGATTTCTCTCCAGATGGGTAATTCCTATGTTCTGGAGATGCTGAAGGT
AGGGCATATTTCTGGGATTGGAAAAGTGGAAAGAATTATAAAGTAATATAGGCTCATGAC
TAAGTCTGTATTGATATAAGATGGCATCCTATAGAAACATCTAAAGTAGCTACATGTGGA
TGGGATGGTCTCATTAAATATTGGGATTGA


>TTHERM_00494570(protein)
MIVDYSDSDPEPEFQKKRVEESANSKSFAIAVNVKPDVNTSKLEQEREENRLRQLNQIYN
SGNSEQNKKNNHLTGKVESYNMHSFSFDQQFYNFKNRGYAYDPQLDENRIVVNDAKFPEL
AQVIHYGGNVDPNMLDTQGAFISQSNEEKQKQKQLKALREKTGAVTDGTYAGPWANYQGE
NIKPKELTQEEKLELEKKKIEEQEEAKIKKEKKRKQKLKEKGFEIDDDEDQENEGKKAKD
KEGNEEQEQKQLEGEGQPEEAKKQKEKSEVTTSIFHDAVPYFDYKGRSYIQPPIDLKPRE
HVCYIPKKQVHCWSGHEKGVQAIRFFPKFGHYLLSASLDTTVKLWDVMGNKKCVRTYMGH
KQAVRDIEFTNDGRHFLSCSYDKNVLYWDTETGKIVRTFNIKKYPYQARFNPDEGKQSSF
ILASSNKKVLQYDVRSGARTQVYDEHLGAVNTVTFVDYGRKFVSTSDDKKIFLWGFGIGV
VEKHIAEPDMTAVANTNIHPTEKFFAGQCSDNKIQIYDTKGGNFRLNKKKLFKEHVSSGY
AIGLDFSPDGQFLCSGDAEGRAYFWDWKSGKNYKVIQAHDQVCIDIRWHPIETSKVATCG
WDGLIKYWD


>TTHERM_00494570(gene)
ATGATTGTCGATTATAGTGATAGCGATCCAGAACCAGAATTTTAAAAGAAAAGAGTAGAA
GAAAGCGCAAATAGCAAAAGTTTTGCTATTGCAGTAAATGTTAAACCTGATGTAAATACT
TCAAAGTTGGAGTAAGAAAGGGAAGAGAATAGATTAAGGTAGTTAAATTAGATTTACAAT
AGCGGAAATAGTGAATAAAATAAAAAAAACAATCATTTAACTGGCAAAGTAGAGAGCTAC
AATATGCATAGTTTTAGTTTTGACTAGCAATTTTATAATTTCAAGAATAGAGGCTATGCA
TATGATCCTTAGTTAGATGAAAATAGAATAGTTGTAAATGATGCTAAATTCCCAGAGCTT
GCTTAAGTTATTCATTATGGAGGAAATGTCGATCCTAATATGCTTGATACATAGGGAGCA
TTTATCTCACAAAGTAATGAAGAAAAATAAAAACAAAAGTAATTAAAAGCCTTGAGAGAA
AAAACAGGTGCTGTTACTGATGGTACTTATGCCGGTCCTTGGGCAAATTATCAAGGAGAA
AATATAAAACCAAAAGAATTAACTCAAGAAGAGAAATTAGAACTAGAAAAAAAGAAAATT
GAAGAATAGGAAGAAGCTAAGATTAAAAAAGAAAAGAAAAGAAAGTAAAAACTAAAAGAA
AAGGGCTTTGAAATAGATGATGATGAAGATTAAGAAAATGAAGGAAAAAAAGCTAAAGAT
AAAGAAGGAAACGAAGAGTAAGAATAAAAATAATTAGAAGGTGAAGGTTAACCTGAAGAA
GCTAAAAAATAAAAAGAAAAAGTAAATATATAATTTATTTTTTAGGTTATTTAAAGAATA
TTAAGTATGCAACATACATTCTCTCATATACATACAAATTTATTCATTGTTAATAAAACA
ATTTATATCTATAAAATTAGAGCGAAGTAACAACGTCTATTTTTCACGATGCTGTACCTT
ACTTTGATTATAAAGGTAGAAGCTACATATAACCTCCTATTGATTTAAAACCTAGAGAGC
ATGTATGCTACATACCTAAAAAGTAAGTTCACTGCTGGTCAGGTCATGAAAAGGGAGTTT
AAGCTATTAGATTTTTCCCTAAATTTGGTCATTATTTGTTATCAGCATCTCTTGATACCA
CAGTAATTAATTATTTATTAGCAAAAGCATTTTATTTCGATTATTAAAACTTATATTTTT
TCTATAGGTAAAATTATGGGATGTAATGGGTAATAAGAAATGTGTAAGAACATATATGGG
ACATAAATAAGCTGTTAGAGATATTGAGTTTACTAATGATGGAAGACATTTCCTCTCTTG
TTCTTATGATAAAAATGTATTATATTGGGATACTGAGACTGGTAAAATTGTAAGAACTTT
CAATATTAAGAAGTACCCATACCAGGCAAGATTTAACCCAGACGAGGGTAAATAAAGCTC
ATTTATTCTTGCTTCTTCCAATAAAAAAGTGTTACAATACGATGTTAGATCTGGAGCAAG
AACATAAGTTTATGATGAGCATTTAGGTGCAGTTAACACAGTTACTTTTGTTGACTATGG
TAGAAAATTTGTTTCTACTTCTGATGATAAAAAAATATTCTTGTGGGGCTTTGGTATAGG
TGTCGTCGAAAAGCATATTGCAGAACCAGATATGACAGCTGTTGCAAACACAAACATTCA
TCCTACAGAAAAGTTCTTTGCAGGCCAATGCTCAGATAATAAAGTAATTTTAATTTATTT
ATCTTTTAGTTTATCTGAATGAACAATTTACTAAATTGACTATAATTATAGCAAGGTTCT
AATTTTAAATGTTTTTATCAAATAGATTTAAATTTATGATACTAAAGGAGGTAACTTTAG
ACTTAACAAGAAAAAATTATTTAAAGAACACGTTTCTTCTGGTTATGCAATTGGTTTAGA
TTTCTCTCCAGATGGGTAATTCCTATGTTCTGGAGATGCTGAAGGTAGGGCATATTTCTG
GGATTGGAAAAGTGGAAAGAATTATAAAGTAATATAGGCTCATGACTAAGTCTGTATTGA
TATAAGATGGCATCCTATAGAAACATCTAAAGTAGCTACATGTGGATGGGATGGTCTCAT
TAAATATTGGGATTGA