Identifiers and Description

Gene Model Identifier

TTHERM_00530350

Standard Name

PRP12 (pre-mRNA processing factor 12)

Aliases

PreTt04698 | 67.m00213 | 3684.m00083

Description

CPSF A subunit region family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 31.6%

TetraMine Data

TTHERM_00530350

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_18630
WormBaseWBGene000193239.997093137033517e-262locus:teg-4 status:Partially
_confirmed UniProt:O44985
protein_id:CCD68627.1
Tetrahymena borealisEI9_13616.19.997093137033517e-262CPSF A subunit region family p
rotein (1198 aa)
DictyBaseDDB_G02825699.997093137033517e-262sf3b3 on chromosome: 3 positio
n 5947254 to 5951124
OxytrichaContig1943.0.g129.997093137033517e-262CPSF A subunit region
SGDYML049C1.0003292389192957e-45RSE1 Protein involved in pre-m
RNA splicing; component of the
pre-spliceosome; associates w
ith U2 snRNA; involved in ER t
o Golgi transport

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00530350(coding)
ATGATGAACTTATACAGTTTAACGCTGTTATAACCAACAGCTATTTTAAAAGCAGTATAC
GGTAATTTTTCAGGACCTAAAGCTTAGGAAATTGCTGTAGCTAAAGGAAAAGTTTTAGAA
ATTCTCACTCCAGATGAAAATAATTCAGGTAAATTAAGGGTAGTACACTCAGAAGAAGTA
TTTGGTATCATAAGGACTATTAACATTTTCAGGTTGCATGGTCAAACTTAAGATTATATC
ATAGTTGGTTCAGATAGCGGTAGAATAGTTATTTTGAAATTTAATAAAGAAAAGGGAGAG
TTTGAAAAAGTTCATTAAGAGACATATGGAAAAACAGGGTGTCGTCGTATTGTACCTGGT
TAATATATAGCAGTAGATCCTAAAGGTCGTGCTTGCATGTTTGCAGCAATTGAAAAATAA
AAGTTTGTATACATTTTAAATAGAGATAATGAAGATAAGTTGACCATTTCATCTCCTTTA
GAAGCACATAAATCACATACACTTTGCTATGATATAATAGGTATTGATGTAGGCTATGAA
AATTCATAATTTGCTTGTATTGAGTGTGATTACGGTGAGGTTGAATAAAAAGATTCAGCT
GTTCACACTGGATAAATATAAAAATAGCTTACAATTTATGAATTGGATTTCGGTTTAAAT
CATGTCGTAAAAAAATCATCTGAACCTATTCCCGAAACTGCTCATATGCTTCTTCCAGTT
CCTGGTCTACCTGATGGTCCTGGAGGAGTGTTAATTGCTTGTGAAGATATGTTAATATAT
AAAGGAAATAATTAAGAATTAAAATGTAGATATCCTTAAAGATTTAGTACCAGCAAAATT
ATGATTAACTCCTTTGGTTTCCTAAAGCAAAAATCAAAAAACTAAAATCTCTCATTTTTT
TTATTACAAACTGAATTGGGAGATTTATTCAAATTATAGATTAAAAGTACAGATGATAAA
GTTCATGGATTGACATTATAATATTTTGATTCTATTCCAACTGCTATTTCAATTTGTATT
ACTAAAACTGGTCACCTGTTTGCAGCATGTGAAAAAGGAGATCACTTGCTCTATAGATTT
AAATCTCTTGGTGAATAAGAAGAAAGACCCACCAAAACTACATCAGCAGACTTCGAGTAA
TAGGCTATTTTTATTCCTCGTAAGCTAGTAAATTTAGAACAAGTTGACTCTCTTGATAAT
CTTTCAGCTATCAGTGATATCAAAGTTAATGATTTAACTGGCGAAGGTAATCCTTAAATA
TACGCATTATGTGCTGCTGGTAGTAGAAGTACTTTAAGAATATTACGTCATGGTTTGTAA
GTCAGTGAATATGCAACAAGTAGATTGCCATTAAGACCTAACGGTATTTGGACAATTAAG
TAAAGACATGATGAAGGTTTAACAAAATATATTGTGTTAAGTAGCAGCAAAAAAACTTAT
GTTCTTTCTATTAAAGATACTATTTCTGCAGTTAATGACTCCAGTTTAGATACAAATAGT
CAAACTCTTCATGCTGGTATTTTAGAAAATAATTGCATAATCCAAGTTACTCCAGAATCA
TTTAGATAAATTAGAGATAACAGAGTTACTTTATATAAAACAGAATCAAATAAATTCGTG
AAAGCATGCTCTAATTCTAGATAAATTGCATTAGCATTATAAGGAGGCCAAGGATAACCC
GGTGGTGATATTATTTATTTCGAATTCGATCTTGGTGGTTAGCTCAAAAGAATCGAAGAA
AAGGCTAAATTAACTTCAGATATTGAATGCATAGATATAGGTGAAGTTCCAATAGGGCGT
CCAAAATTCAAATTTTTAGCTGTTGGATGCAAAGATTAAACAGTAAGAATTTTGAGTTTA
GAATAAGATCAATACCTCTAAAGATTGAGTTTATAGGCTCTTCCAGGTATTCCAGAAAGT
GTTAGCTTAATTGAAATGAAGAGAGGCACAGGAACTGAGTAAGAAGCTGAGGAATATTAA
CTTTATTTGTTTGTTGGTTTACAAAATGGTATTCTTTTAAGAGCAACTGTTGACTAAGTT
ACTGGTTCTTTGTCTGATGTTAGAACTAGAGTTCTCAGCGCTGCTCCTATTCGTACTTGT
AAGTATGTTGTTTAAGGATAACCTGCTTTATTGGCTCTCTCTACTCGTCCTTGGATATGT
TATACCTATTTAGGAAAGTACTAAATGGTTCCTATCTCCTATGATATGCTCGAATATGCT
GCTCCTGCAGTTTTTAATATGTAAGGAGAGTAAAAGTAATGTATAGTATCTACTTCAGGT
GAGTCCGTTCGTATTATTGAACCATAAAAGTATGGAGATTTACTCAATCAATAAGTTATA
AAATTGCGTTATTCACCTCGTAAAATGGCAATCCATGAAAGATCACATAATATAGTCTTA
ATTGAATCTGATAATAAGGTTTATAATGAATCTTAAAAGAAGTAGCTTATCGAATAGTAT
TATAGTAACTAAAACAAAGGTGATTTAGCCACTCAAGTAGATCTCTTAACAGCTCCTTCT
GGTAACTGGGCTTCTTGTGTTCGTATAGTCGATCCTGTTACTCGTAAAACTCTTAATATT
TATGAATTAGAAAATAACGAGCACGCCCTTTCTATGTGTATGGTAAACTTTGATAACAAA
GATGAGACTTATGTTTGTGTTGGTACTGTTAAGGATTATTAAGTTCATCCAAATAGAAAT
TTCTCTGTTTGTTATATAAATACTTTCTAGCTTAACGAAAAGTTGAATACTCTTGAATTG
CTCCATAAAACTGAGATATTTGAAATTCCAGGCGCCTTGCATGCTCATAAAGGAAAATTA
CTTGCTGGATGTGGCACATTTTTAAGATATTATGAACTTGGTAAGAAGAAATTATTGAAA
AAAGCAGAAATTAAAGGTTTACAATCTCCAGTTAATGGAATTTAAACATTTGGAGATAGA
ATATATGTATCTATGGTTGCTGACTCTGTCCATGTCCTCAAGTATCGCTCTAAAGACTAG
ACATTTTATGAGGTTTGTGATGATATATTACCAAGATGGATGTCTTCCTTTTAAGTTCTT
GATTATCATACTTATATTGGTGGAGATAAATTTGAGAATGCATTTGTCTGTAGAGTACCG
TCAAATGCTGATGAAGAAATGGAAGAAAATCCTATGGCTTATAAATTAAGATGGGAAACA
GGATATTTGAATGGAGCTCCTTTCAAAACTGAACAAATTTGCCACTTTTATGCTGGCGAA
GTAATAACAACATTACAAAAAGCAAGTTTAGTTTCAACAGGAAATGAAATAGTATTATAT
GGAACAAGTATGGGCTCAATAGGTGCTTATTTACCTTTCCAAACAAAGGAAGATATAGAT
TTCTTTATTCATTTAGAAATGTATCTACGTTTAGACGTTCTTCCATTGGCTGGTAGAGAT
CACGTTATGTTCAGATCTTTCTATGGTCCAGTCAAATCCGTAATCGATGGAGATCTTTGC
GAATAATTCATAAAATTAAGTTCAGGTAAATAAAAAGTGTTAGCAGATGAAATGGATAGA
CATCCACACGAAGTACATAAAAAATTAGATGAAATCAGAAATAAAATTCTTTGA


>TTHERM_00530350(protein)
MMNLYSLTLLQPTAILKAVYGNFSGPKAQEIAVAKGKVLEILTPDENNSGKLRVVHSEEV
FGIIRTINIFRLHGQTQDYIIVGSDSGRIVILKFNKEKGEFEKVHQETYGKTGCRRIVPG
QYIAVDPKGRACMFAAIEKQKFVYILNRDNEDKLTISSPLEAHKSHTLCYDIIGIDVGYE
NSQFACIECDYGEVEQKDSAVHTGQIQKQLTIYELDFGLNHVVKKSSEPIPETAHMLLPV
PGLPDGPGGVLIACEDMLIYKGNNQELKCRYPQRFSTSKIMINSFGFLKQKSKNQNLSFF
LLQTELGDLFKLQIKSTDDKVHGLTLQYFDSIPTAISICITKTGHLFAACEKGDHLLYRF
KSLGEQEERPTKTTSADFEQQAIFIPRKLVNLEQVDSLDNLSAISDIKVNDLTGEGNPQI
YALCAAGSRSTLRILRHGLQVSEYATSRLPLRPNGIWTIKQRHDEGLTKYIVLSSSKKTY
VLSIKDTISAVNDSSLDTNSQTLHAGILENNCIIQVTPESFRQIRDNRVTLYKTESNKFV
KACSNSRQIALALQGGQGQPGGDIIYFEFDLGGQLKRIEEKAKLTSDIECIDIGEVPIGR
PKFKFLAVGCKDQTVRILSLEQDQYLQRLSLQALPGIPESVSLIEMKRGTGTEQEAEEYQ
LYLFVGLQNGILLRATVDQVTGSLSDVRTRVLSAAPIRTCKYVVQGQPALLALSTRPWIC
YTYLGKYQMVPISYDMLEYAAPAVFNMQGEQKQCIVSTSGESVRIIEPQKYGDLLNQQVI
KLRYSPRKMAIHERSHNIVLIESDNKVYNESQKKQLIEQYYSNQNKGDLATQVDLLTAPS
GNWASCVRIVDPVTRKTLNIYELENNEHALSMCMVNFDNKDETYVCVGTVKDYQVHPNRN
FSVCYINTFQLNEKLNTLELLHKTEIFEIPGALHAHKGKLLAGCGTFLRYYELGKKKLLK
KAEIKGLQSPVNGIQTFGDRIYVSMVADSVHVLKYRSKDQTFYEVCDDILPRWMSSFQVL
DYHTYIGGDKFENAFVCRVPSNADEEMEENPMAYKLRWETGYLNGAPFKTEQICHFYAGE
VITTLQKASLVSTGNEIVLYGTSMGSIGAYLPFQTKEDIDFFIHLEMYLRLDVLPLAGRD
HVMFRSFYGPVKSVIDGDLCEQFIKLSSGKQKVLADEMDRHPHEVHKKLDEIRNKIL


>TTHERM_00530350(gene)
ATGATGAACTTATACAGTTTAACGCTGTTATAACCAACAGCTATTTTAAAAGCAGTATAC
GGTAATTTTTCAGGACCTAAAGCTTAGGAAATTGCTGTAGCTAAAGGAAAAGTTTTAGAA
ATTCTCACTCCAGATGAAAATAATTCGTAAAACTAATTTTTATAAATGGCATTATAATAT
CAAACAAAAATCCTTAAAAGTTGTGATTTTTAAAACGCTTCAAGGACAGACAATTAAAAT
AAATCATTTGCAAAATTTCTATTTTAAAATATTAAAAAAATTATATAAATAGAGGTAAAT
TAAGGGTAGTACACTCAGAAGAAGTATTTGGTATCATAAGGACTATTAACATTTTCAGGT
TGCATGGTGTAATTAATTATCTATTATAAATCAATAAATATTTAAATAATATTCAAAATT
GATCTAATAACATTTTGAACTATATAATGACCTTTGTTTTTCTAAATTCATAAACAAAAT
ATTTTTTTATTATACAGCAAACTTAAGATTATATCATAGTTGGTTCAGATAGCGGTAGAA
TAGTTATTTTGAAATTTAATAAAGAAAAGGGAGAGTTTGAAAAAGTTCATTAAGAGACAT
ATGGAAAAACAGGGTGTCGTCGTATTGTACCTGGTTAATATATAGCAGTAGATCCTAAAG
GTCGTGCTTGCATGTTTGCAGCAATTGAAAAATAAAAGTTTGTATACATTTTAAATAGAG
ATAATGAAGATAAGTTGACCATTTCATCTCCTTTAGAAGCACATAAATCACATACACTTT
GCTATGATATAATAGGTATTGATGTAGGCTATGAAAATTCATAATTTGCTTGTATTGAGT
GTGATTACGGTGAGGTTGAATAAAAAGATTCAGCTGTTCACACTGGATAAATATAAAAAT
AGCTTACAATTTATGAATTGGATTTCGGTTTAAATCATGTCGTAAAAAAATCATCTGAAC
CTATTCCCGAAACTGCTCATATGCTTCTTCCAGGTAAAATATAATCTTTATTTCTAATTA
TTTAAAACATTTTATTAATAATGCATAGTTCCTGGTCTACCTGATGGTCCTGGAGGAGTG
TTAATTGCTTGTGAAGATATGTTAATATATAAAGGAAATAATTAAGAATTAAAATGTAGA
TATCCTTAAAGATTTAGTACCAGCAAAATTATGATTAACTCCTTTGGTTTCCTAAAGCAA
AAATCAAAAAACTAAAATCTCTCATTTTTTTTATTACAAACTGAATTGGGAGATTTATTC
AAATTATAGATTAAAAGTACAGATGATAAAGTTCATGGATTGACATTATAATATTTTGAT
TCTATTCCAACTGCTATTTCAATTTGTATTACTAAAACTGGTCACCTGTTTGCAGCATGT
GAAAAAGGAGATCACTTGCTCTATAGATTTAAATCTCTTGGTGAATAAGAAGAAAGACCC
ACCAAAACTACATCAGCAGACTTCGAGTAATAGGCTATTTTTATTCCTCGTAAGCTAGTA
AATTTAGAACAAGTTGACTCTCTTGATAATCTTTCAGCTATCAGTGATATCAAAGTTAAT
GATTTAACTGGCGAAGGTAATCCTTAAATATACGCATTATGTGCTGCTGGTAGTAGAAGT
ACTTTAAGAATATTACGTCATGGTTTGTAAGTCAGTGAATATGCAACAAGTAGATTGCCA
TTAAGACCTAACGGTATTTGGACAATTAAGTAAAGACATGATGAAGGTTTAACAAAATAT
ATTGTGTTAAGTAGCAGCAAAAAAACTTATGTTCTTTCTATTAAAGATACTATTTCTGCA
GTTAATGACTCCAGTTTAGATACAAATAGTCAAACTCTTCATGCTGGTATTTTAGAAAAT
AATTGCATAATCCAAGTAATTTATTTTATTTTTAAATTATTTCTAACCAAAAGAAATTTC
AATTATTAAAAATGAAAGATAATAAAACGATCAAATTATATTTACAAATATTTTATTTAA
ATGATCTAAAACTAATTTTGAATAAAATAATGAAATTTTTAAAAAATAAAATTTTAAGCA
AATAAATTAATTATTTATTTATTTTTTTATTTATTTATTAAATTAGGTTACTCCAGAATC
ATTTAGATAAATTAGAGATAACAGAGTTACTTTATATAAAACAGAATCAAATAAATTCGT
GAAAGCATGCTCTAATTCTAGATAAATTGCATTAGCATTATAAGGAGGCCAAGGATAACC
CGGTGGTGATATTATTTATTTCGAATTCGATCTTGGTGGTTAGCTCAAAAGAATCGAAGA
AAAGGCTAAATTAACTTCAGATATTGAATGCATAGATATAGGTGAAGTTCCAATAGGGCG
TCCAAAGTAAGATTAATAATTGTAAATTAGTATTTATAAAAAATATATTATTTATTTAAA
ATAGATTCAAATTTTTAGCTGTTGGATGCAAAGATTAAACAGTAAGAATTTTGAGTTTAG
AATAAGATCAATACCTCTAAAGATTGAGTTTATAGGCTCTTCCAGGTATTCCAGAAAGTG
TTAGCTTAATTGAAATGAAGAGAGGCACAGGAACTGAGTAAGAAGCTGAGGAATATTAAC
TTTATTTGTTTGTTGGTTTACAAAATGGTATTCTTTTAAGAGCAACTGTTGACTAAGTTA
CTGGTTCTTTGTCTGATGTTAGAACTAGAGTTCTCAGCGCTGCTCCTATTCGTACTTGTA
AGTATGTTGTTTAAGGATAACCTGCTTTATTGGCTCTCTCTACTCGTCCTTGGATATGTT
ATACCTATTTAGGAAAGTACTAAATGGTTCCTATCTCCTATGATATGCTCGAATATGCTG
CTCCTGCAGTTTTTAATATGTAAGGAGAGTAAAAGTAATGTATAGTATCTACTTCAGGTG
AGTCCGTTCGTATTATTGAACCATAAAAGTATGGAGATTTACTCAATCAATAAGTTATAA
AATTGCGTTATTCACCTCGTAAAATGGCAATCCATGAAAGATCACATAATATAGTCTTAA
TTGAATCTGATAATAAGGTTTATAATGAATCTTAAAAGAAGTAGCTTATCGAATAGTATT
ATAGTAACTAAAACAAAGGTGATTTAGCCACTCAAGTAGATCTCTTAACAGCTCCTTCTG
GTAACTGGGCTTCTTGTGTTCGTATAGTCGATCCTGTTACTCGTAAAACTCTTAATATTT
ATGAATTAGAAAATAACGAGCACGCCCTTTCTATGTGTATGGTAAACTTTGATAACAAAG
ATGAGACTTATGTTTGTGTTGGTACTGTTAAGGATTATTAAGTTCATCCAAATAGAAATT
TCTCTGTTTGTTATATAAATACTTTCTAGCTTAACGAAAAGTTGAATACTCTTGAATTGC
TCCATAAAACTGAGATATTTGAAATTCCAGGCGCCTTGCATGCTCATAAAGGAAAATTAC
TTGTAATTTATTTTTTAAAATTAAAAATTATAAAATTTAAATCATTTATTTTAATAAAAG
GCTGGATGTGGCACATTTTTAAGATATTATGAACTTGGTAAGAAGAAATTATTGAAAAAA
GCAGAAATTAAAGGTTTACAATCTCCAGTTAATGGAATTTAAACATTTGGAGATAGAATA
TATGTATCTATGGTTGCTGACTCTGTCCATGTCCTCAAGTATCGCTCTAAAGACTAGACA
TTTTATGAGGTTTGTGATGATATATTACCAAGATGGATGTCTTCCTTTTAAGTTCTTGAT
TATCATACTTATATTGGTGGAGATAAATTTGAGAATGCATTTGTCTGTAGAGTACCGTCA
AGTAATTAGTTTTATTTTATTAAATTTAAGAATTCAATTTATTTTTATATTTAGATGCTG
ATGAAGAAATGGAAGAAAATCCTATGGCTTATAAATTAAGATGGGAAACAGGATATTTGA
ATGGAGCTCCTTTCAAAGTATCAATTTATTTATTTATCAAAAATAAAATATTAAATTTTT
TAATTAAATAGACTGAACAAATTTGCCACTTTTATGCTGGCGAAGTAATAACAACATTAC
AAAAAGCAAGTTTAGTTTCAACAGGAAATGAAATAGTATTATATGGAACAAGTATGGGCT
CAATAGGTGCTTATTTACCTTTCCAAACAAAGGAAGATATAGATTTCTTTATTCATTTAG
AAATGTATCTACGTTTAGACGTTCTTCCATTGGCTGGTAGAGATCACGTTATGTTCAGAT
CTTTCTATGGTCCAGTCAAAGTAAAAAATAATTTATAATTAAATATCTTTATTTAAATAA
TTTCTTTAATATAGTCCGTAATCGATGGAGATCTTTGCGAATAATTCATAAAATTAAGTT
CAGGTAAATAAAAAGTGTTAGCAGATGAAATGGATAGACATCCACACGAAGTACATAAAA
AATTAGATGAAATCAGAAATAAAATTCTTTGA