Identifiers and Description

Gene Model Identifier

TTHERM_00343680

Standard Name

PRP11 (Pre-mRNA Processing factor 11)

Aliases

PreTt26147 | 35.m00208 | 3695.m00041

Description

Spliceosome associated protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00343680

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14698.12.0001055857497602e-161spliceosome associated protein
(230 aa)
OxytrichaContig15681.0.g151.9998521972819316e-89Zinc-finger of C2H2 type
WormBaseWBGene000086832.0006821221283624e-88locus:repo-1 status:Confirme
d UniProt:Q19335 protein_i
d:CAA92593.2
DictyBaseDDB_G02938769.996373193201036e-79sf3a2 on chromosome: 6 positio
n 3412404 to 3413152
Stentor CoeruleusSteCoe_83021.3336148155022614e-34
SGDYDL043C0.000000000000001999258566166494PRP11 Subunit of the SF3a spli
cing factor complex, required
for spliceosome assembly

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00343680(coding)
ATGGTGGATAGATAACACAGACCAGGTGCTAAGACTGGTTCAGGAGGACCTGCTTCTTCT
TAAGATGCCAATATTGAGCACAGAGAAAGACTGAAAAAGCTAGCCTTAGAAACAATAGAT
ATTAAGAAGGATCCTTATTTCATGACAAATCACTTGGGTACTTATGAATGCAGATTGTGT
CTAACTCTGCACACAAACGAAGGTAGTTATTTAGCTCACACATAAGGTAAAAAGCATCAA
ACTAATTTATAAAGAAGATAAAGCAAAGAACGCTAAGAACAGAATATACAGTTGCAGCAA
AACTAAACAAAAGGGCTACAAAAGAAGAAAACCATCAAAATTGGAAGACCTGGATATAAA
ATTTTTAAGATGATTGATCCAACTTCTGGATAAAAGTAGATAACTTTTGAGATAGATTAT
GAGTAAATAGATGCCAGTTGGAAACCCTTTTATAGAATTATGAGTTCTTACGAGTAAAAA
GTAGAGTAGTTTGATAAAAATTATTAATATGTAGTCTTTGCCGCTGAGCCATATGATAAC
ATAGCCTTTAAAATACCAAATATGGAAATAGATATGGAAGAAGGGAAGTTTTACTAAGAT
TGGAATAAAGATAAGAAGAAATACACACTCCATTTAACATTTAAAGATAGACAAAATAAA
TAATCAAGAAATCAAAAGAATTGA


>TTHERM_00343680(protein)
MVDRQHRPGAKTGSGGPASSQDANIEHRERLKKLALETIDIKKDPYFMTNHLGTYECRLC
LTLHTNEGSYLAHTQGKKHQTNLQRRQSKERQEQNIQLQQNQTKGLQKKKTIKIGRPGYK
IFKMIDPTSGQKQITFEIDYEQIDASWKPFYRIMSSYEQKVEQFDKNYQYVVFAAEPYDN
IAFKIPNMEIDMEEGKFYQDWNKDKKKYTLHLTFKDRQNKQSRNQKN


>TTHERM_00343680(gene)
ATGGTGGATAGATAACACAGACCAGGTGCTAAGACTGGTTCAGGAGGACCTGCTTCTTCT
TAAGATGCCAATATTGAGCACAGAGAAAGACTGAAAAAGCTAGCCTTAGAAACAATAGAT
ATTAAGAAGGATCCTTATTTCATGACAAATCACTTGGGTACTTATGAATGCAGATTGTGT
CTAACTCTGCACACAAACGAAGGTAGTTATTTAGCTCACACATAAGGTAAAAAGCATCAA
ACTAATTTATAAAGAAGATAAAGCAAAGAACGCTAAGAACAGAATATACAGTTGCAGCAA
AACTAAACAAAAGGGCTACAAAAGAAGAAAACCATCAAAATTGGAAGACCTGGATATAAA
ATTTTTAAGATGATTGATCCAACTTCTGGATAAAAGTAGATAACTTTTGAGATAGATTAT
GAGTAAATAGATGCCAGTTGGAAACCCTTTTATAGAATTATGAGTTCTTACGAGTAAAAA
GTAGAGTAGTTTGATAAAAATTATTAATATGTAGTCTTTGCCGCTGAGCCATATGATAAC
ATAGCCTTTAAAATACCAAATATGGAAATAGATATGGAAGAAGGGAAGTTTTACTAAGAT
TGGAATAAAGATAAGAAGAAATACACACTCCATTTAACATTTAAAGATAGACAAAATAAA
TAATCAAGAAATCAAAAGAATTGA