Identifiers and Description

Gene Model Identifier

TTHERM_00529660

Standard Name

PRP10 (pre-mRNA processing factor 10)

Aliases

PreTt04635 | 67.m00150 | 3684.m00020

Description

splicing factor 3B subunit 1

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF02985 ) HEAT repeat
  • ( PF07813 ) LTXXQ motif
  • ( PF08064 ) UME (NUC010) domain
  • ( PF08920 ) Splicing factor 3B subunit 1
  • ( PF00514 ) Armadillo/beta-catenin-like repeat
  • ( PF07498 ) Rho termination factor, N-terminal domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.7%

TetraMine Data

TTHERM_00529660

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_341160
WormBaseWBGene000116059.997093137033517e-262status:Partially_confirmed U
niProt:G5EEQ8 protein_id:CAA
90777.1
Tetrahymena borealisEI9_13683.19.997093137033517e-262splicing factor 3B subunit 1 (
1221 aa)
DictyBaseDDB_G02759579.997093137033517e-262sf3b1 on chromosome: 2 positio
n 6197621 to 6200891
OxytrichaContig16616.0.g99.997093137033517e-262Splicing factor 3B subunit 1
SGDYMR288W9.997093137033517e-262HSH155 U2-snRNP associated spl
icing factor that forms extens
ive associations with the bran
ch site-3 splice site-3 exon r
egion upon prespliceosome form
ation; similarity to the mamma
lian U2 snRNP-associated splic
ing factor SAP155

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00529660(coding)
ATGAGTAATAAAGGTAGCTCAAATCAATTCGTTGATGATGATGGAAGAGAAATTCCAGGA
TAAAAGCCAGTCAAAAAAAGATTTGCATATAATGCTCCGGAAGAATTAATAGAAGAAGCA
AAGATGTAAGGAGCAGATAACGATGATAATGATGATTTATTCAAAAAGAGTTAACAAAGA
GTTACTGATACTCAAAATTCATATCAGTTAAGACAATAAAATAGATAACTTTAGTAAAAG
AGTTATGATGCATTTGCTGATGGTGGTAAATCGCCAGATGAGAATTCAATTAAATTTTCA
GAGAGATTAAAGGAATAAAAGCTTGAAAACGAAAGGGTAGCGTTAGAATAAAAAATAGTT
AAAGAAGCTCAATAAGCTGAATACAATAGTAAGTTTTCAAGTGTACCAACCTAAGTAAAC
TAAAATGCACCTTTAAGATAAGCTAACACTTCAAAAGGTTCATCCAAATTTAGTGATGTT
GATACCGATACTTCTTTTTCAAGTGGCGCTATGTCTGCTAACAGAATGGGATCAAAATGG
GGAGAAACTCCTAAGAGATAAAGTGGTTTTGAACAATCTACTCCTGTAAAGAGACAAAGA
TGGGATATGACACCTTAATAAAGTGGAGGTTTTGGATAAACTCCTTAAAAAGTTGGTGGT
ATGTTTGGTGAAACACCTACACCTGGTCACTTAATCTAAGGTACACCAAGCAGATTTGGT
GAAACCCCTACTCCTAAAAGAAGTACCACACGTACTCGTTGGGATGAATAAACTCCTAAA
AATATATAAACACCTTTAGGAGGTTATATGGGTATTACACCTACTCCTGGTGGTTTATAT
ACTCCCTAAAATCAACCCAATTTAACTCCTGAATAAATTATGAATCTTAAATAATTACAA
GCTAATGAAATGAGAAATAGACCTCTCACTGATGAAGATCTTGATCAAATGTTACCTGGA
CCTGGAGACGGTTATGAAATTGTTAAACCACCAGATAGCTACAACCCTCCTAAAAATATG
ATGAGATAGTTTTTAATGTCATAATAAACTCCGTCAATGACACCCATGGGTTATTAAATC
CCTGATGAAATGACTAAGCCTATTGAAGTTCCTCAATCTCCAAGCATAAATGGTTTGCCT
TCAATTAAACCTGAAGACTTGGCTTATTTTGGAGAGTTATAAAACCCTGTCAATGAATCA
GAGTTAACTCCTGAGGAATTGAAGAAGAGAAAAATAAAAGAATTATTGCTCAAAATTAAA
AGAGGTACTCCTTAAATGAGAAAATCTGCTTTACGTTAAATTACTTAAAATGCAAGAGAG
TTTGGTGCTGATCTTTTGTTTAACGATATTTTGACTTTGCTTATGTCTCCAACACTTGAA
GTACAAGAACGTCACTTGCTTGTTAAAGTCATTGATCGTATTCTCTACAAATTAGACGAT
TTAGTCCGTCCTCATGTGCATAATATTTTGGTCGTTATTGAACCCTTGCTTATTGATGAA
GATTATTACGCTCGTGTTGAAGGTCGTGAAATTATTTCTAACTTAGCTAAGGCTGCCGGT
TTACCTACTATGATTAAAACACTCAAGCCTGATATTGACCATAATGATGAATTCGTACGT
AATACAACAGCTCGTGCATTTGCCGTCGTCGCAAGTAGTTTAGGTATTTCATCTATGTTA
CCTTTCTTAAAGCCTGTCTGCAAAAGTAAAAAAAGTTGGTACACCCGTCACACTGGTATT
AAAATCGTTTAATAAATTGCTATCTTGATGGGTTGCGCTATTCTTCCTCATCTTCGTTCA
CTTGTTGAAATTATTGAGCTTGGTTTAAAAGATGAACAAAATAAAGTGAGAACAATTACA
AGTCTTGCTCTTGCTGCCTTAGCAGAAGCTGCTACTCCTTATGGTATCGACGCTTTTGCT
AGTGTGTTAATTCCTCTTTGGGAAGGTATTACATAGTACAAGGGTAAAAGTTTAGCTGCC
TTCCTTAAGGCTATTGGCTTTATCATTCCATTGATGGATGCTGACAGAGCTCTCGAATAC
ACTAAAGAAGTAATGGAAATATTGAAAAATGAATTTTCAAATCCTGAAGAAGAAATGCGT
AAAATTGTATTAAAAGTAGTAAAGTAGTGTGTTAGTTGTTAGGGTGTTGATGCACAATAC
GTCCGTGAGCATGTTGTACCAAAGTTTTTTGAACAATTTTGGGTATCTCGTATGGCAACT
GATAAGAATTCTCGTTAACTTATTGATACTACTATTGAAATTGCTTCCAAAGTTGGAGGT
GCTGAAATTCTTGAAATTATAGTTCCTCACTTAAAATCAACTAGTGAAGCTTATCGTAAA
ATGGTCATGGAGACTATTGAAAAAATAGTAGCAGCCCTTGGTGTTTCTGACGTTGATAAC
GCTTTAGAATAATAATTAATGGATGGTATCATCTCTGCTTTCCATGAACAAAATAGTGAA
GATACTGGTACCATGCTTAATGGTTTCGGTACTTGTGTTAACGCTTTAGGCTAACGTGCA
AAGCCTTATTTCTCTTAAATTTGTGGTATTATATAATGGCGTCTGAATAACAAGAGTGCT
CGTGTCCGTCAATAAGCAGCTGATCTAATTTCTCGTATAGCTTCTTGTATGAAGAATTGC
AGTGAAGAGAATAGACTTGGTAATTTAGGTCTTTTGTTGTATGAGAGTTTGGGTGAAGAA
TATCCTGAAGTCCTTGGTTCTATCCTTGGTGGTTTGAAAGCAATAGTAAATGTCATAGGT
ATGAATAAAATGACACCACCAATAAAAGATCTATTACCTCGTCTTACTCCAATTTTGAAA
AATAGACATGAAAAAGTTTAAGAAAACTCTATTGATTTAATAGGTAGAATTTCAGATAGA
GGAGCTGAGCATGTTTCTCCTAAAGAATGGATGCGTATATGTTTCGATTTACTTGATCTT
CTTAAGGCACATAAAAAGGGTATTCGTCGTGCTACAGTCAATACATTTGGTTATATTGCT
AAAGCCATCGGTCCATAGGATGTTTTGGTTACTTTATTGAATAACTTGAAGGTCTAAGAA
AGACAACTTCGTGTTTGCACAACAGTAGCTATTGCTATCGTAGCAGAAACATGTGGTCCC
TTCACAGTCCTCCCTGCTTTGATGAATGAATATCGTGTCTAAGAATTGAATGTTTAAAAT
GGTGTATTAAAATCTTTATCATTCATGTTTGAATATATTGGAGAAATGGCAAAGAATTAT
ATTGCCGCTATAATTACTCTTCTAGAAGATGCCTTGGTAGATCGTGATCCAGTTCATCGT
CAAACTGCAGCCTCAGCAGTAAAACATTTAGCTCTTGGTGTTTCCAATCTTGGATGTGAA
GATTGCTTAATCCACTTACTCAACTTCATTTGGCCTAACATTTTTGAAACATCTCCTCAC
GTCATCACCGCTATGACCGAAGCTATAGATGCCCTTCGTGTTGCATTAGGACCTGGAGTC
ATATTACTTTATCTTCTTTAAGGATTGTATCATCCAGCTAAAAGAGTTAGACAAGTATAT
TGGAAGTTGTATAACATGATATATGTTGGAAGTTAAGATGCTCTAGTTGCATTTTTCCCA
ACACTTGAAGATGACGAAGGAGAAGATAGAAAACAGTATTCATACTCCAGAAATGAACTG
CAATTAATGCTCTGA


>TTHERM_00529660(protein)
MSNKGSSNQFVDDDGREIPGQKPVKKRFAYNAPEELIEEAKMQGADNDDNDDLFKKSQQR
VTDTQNSYQLRQQNRQLQQKSYDAFADGGKSPDENSIKFSERLKEQKLENERVALEQKIV
KEAQQAEYNSKFSSVPTQVNQNAPLRQANTSKGSSKFSDVDTDTSFSSGAMSANRMGSKW
GETPKRQSGFEQSTPVKRQRWDMTPQQSGGFGQTPQKVGGMFGETPTPGHLIQGTPSRFG
ETPTPKRSTTRTRWDEQTPKNIQTPLGGYMGITPTPGGLYTPQNQPNLTPEQIMNLKQLQ
ANEMRNRPLTDEDLDQMLPGPGDGYEIVKPPDSYNPPKNMMRQFLMSQQTPSMTPMGYQI
PDEMTKPIEVPQSPSINGLPSIKPEDLAYFGELQNPVNESELTPEELKKRKIKELLLKIK
RGTPQMRKSALRQITQNAREFGADLLFNDILTLLMSPTLEVQERHLLVKVIDRILYKLDD
LVRPHVHNILVVIEPLLIDEDYYARVEGREIISNLAKAAGLPTMIKTLKPDIDHNDEFVR
NTTARAFAVVASSLGISSMLPFLKPVCKSKKSWYTRHTGIKIVQQIAILMGCAILPHLRS
LVEIIELGLKDEQNKVRTITSLALAALAEAATPYGIDAFASVLIPLWEGITQYKGKSLAA
FLKAIGFIIPLMDADRALEYTKEVMEILKNEFSNPEEEMRKIVLKVVKQCVSCQGVDAQY
VREHVVPKFFEQFWVSRMATDKNSRQLIDTTIEIASKVGGAEILEIIVPHLKSTSEAYRK
MVMETIEKIVAALGVSDVDNALEQQLMDGIISAFHEQNSEDTGTMLNGFGTCVNALGQRA
KPYFSQICGIIQWRLNNKSARVRQQAADLISRIASCMKNCSEENRLGNLGLLLYESLGEE
YPEVLGSILGGLKAIVNVIGMNKMTPPIKDLLPRLTPILKNRHEKVQENSIDLIGRISDR
GAEHVSPKEWMRICFDLLDLLKAHKKGIRRATVNTFGYIAKAIGPQDVLVTLLNNLKVQE
RQLRVCTTVAIAIVAETCGPFTVLPALMNEYRVQELNVQNGVLKSLSFMFEYIGEMAKNY
IAAIITLLEDALVDRDPVHRQTAASAVKHLALGVSNLGCEDCLIHLLNFIWPNIFETSPH
VITAMTEAIDALRVALGPGVILLYLLQGLYHPAKRVRQVYWKLYNMIYVGSQDALVAFFP
TLEDDEGEDRKQYSYSRNELQLML


>TTHERM_00529660(gene)
ATGAGTAATAAATATTCTATTTATTCAAAATAACTTTTACATACAAATCAATAGAGATTT
TATGAGCTAGATTAAACGTATACTAATAAGTATTTTGTATTAATAGGTAATAAAGGTAGC
TCAAATCAATTCGTTGATGATGATGGAAGAGAAATTCCAGGATAAAAGCCAGTCAAAAAA
AGATTTGCATATAATGCTCCGGAAGAATTAATAGAAGAAGCAAAGATGTAAGGAGCAGAT
AACGATGATAATGATGATTTATTCAAAAAGAGTTAACAAAGAGTTACTGATACTCAAAAT
TCATATCAGTTAAGACAATAAAATAGATAACTTTAGTAAAAGAGTTATGATGCATTTGCT
GATGGTGGTAAATCGCCAGATGAGAATTCAATTAAATTTTCAGAGAGATTAAAGGAATAA
AAGCTTGAAAACGAAAGGGTAGCGTTAGAATAAAAAATAGTTAAAGAAGCTCAATAAGCT
GAATACAATAGTAAGTTTTCAAGTGTACCAACCTAAGTAAACTAAAATGCACCTTTAAGA
TAAGCTAACACTTCAAAAGGTTCATCCAAATTTAGTGATGTTGATACCGATACTTCTTTT
TCAAGTGGCGCTATGTCTGCTAACAGAATGGGATCAAAATGGGGAGAAACTCCTAAGAGA
TAAAGTAATCATTTTTACTTACTTTATTGAATATTAAATTTCAGTTGATTTTAAAAATAT
TTCATTTTTTTTAAGATCAAATCAAATTAATTTTTAAGAATGCCTCAATATTTATTTCTG
AGTCATTTAAAAATAAATAGATATATAAATAAATAGATAGATAGATACTATTTATATTCA
AAAGTATTTAAATTAATACTTTCTTTAAAAAGATATCTCATGAAAGATTTTTTAAATTTG
ATTTGATTTGAACAAATTTTTTTAATATATTCAGAATTTTTAAATTAATTTTATTTTTTA
TAAAAAAGGTGGTTTTGAACAATCTACTCCTGTAAAGAGACAAAGATGGGATATGACACC
TTAATAAAGTGGAGGTTTTGGATAAACTCCTTAAAAAGTTGGTGGTATGTTTGGTGAAAC
ACCTACACCTGGTCACTTAATCTAAGGTACACCAAGCAGATTTGGTGAAACCCCTACTCC
TAAAAGAAGTACCACACGTACTCGTTGGGATGAATAAACTCCTAAAAATATATAAACACC
TTTAGGAGGTTATATGGGTATTACACCTACTCCTGGTGGTTTATATACTCCCTAAAATCA
ACCCAATTTAACTCCTGAATAAATTATGAATCTTAAATAATTACAAGCTAATGAAATGAG
AAATAGACCTCTCACTGATGAAGATCTTGATCAAATGTTACCTGGACCTGGAGACGGTTA
TGAAGTAAAAATTCTTTTCACTAATTCACTAACATAAAATTATGAGAGTAATAATCGAGT
AGACTTGAAAAAATTTTTCTATCTTAAAAAATATTATTAAATAATCAATTTTATTTTTAT
TAAAAAAATAAAATCAGTAAAAATAAAAAAAATATTTTAATTTTAATTTAAAATAAATGC
TTTCGTTGTCGTGATAAAAACACTTCTTTTATAAAAACCTTAGCATTTTCAACAGAAACC
CTCTCAGAGAGCAATTAGAAAATATTTTTATCCTTTCTCCTATTAATTATCTCCATGGTT
AGATACATCTAAGTCTATATGTATATGGAAAATTTGACACAAGTAAAATATGTGAAAGGG
AGATCAACAAACTAGAAACATTGAGCGATTGATGATGGTTGAAGAAAAGTAGGAGAGATA
AATTTAAAATAATGTGGATATGTTAGTTCTTTATGATCTATATAAAAATAAGAATAAAAG
CAAAATAAGTTATATGAATAATTAAAAAAACAACATTTTGAATATTTGAAGCTTTCATAT
TCTCAAAAAAAATGCACCCAATTTGCTATTTAAGTTGGCAGATAAACAAATAGATAGATC
TAATGAATCATCATCTAATCTAACTCGATTATAACTCCACTCTTTTGACTTTAAGTAGCT
TTTATTTAATTTTTTTTTTTATTAATTTAAATAGATTGTTAAACCACCAGATAGCTACAA
CCCTCCTAAAAATATGATGAGATAGTTTTTAATGTCATAATAAACTCCGTCAATGACACC
CATGGGTTATTAAATCCCTGATGAAATGACTAAGCCTATTGAAGTTCCTCAATCTCCAAG
CATAAATGGTTTGCCTTCAATTAAACCTGAAGACTTGGCTTATTTTGGAGAGTTATAAAA
CCCTGTCAATGAATCAGAGTTAACTCCTGAGGAATTGAAGAAGAGAAAAATAAAAGAATT
ATTGCTCAAAATTAAAAGAGGTACTCCTTAAATGAGAAAATCTGCTTTACGTTAAATTAC
TTAAAATGCAAGAGAGTTTGGTGCTGATCTTTTGTTTAACGATATTTTGACTTTGCTTAT
GTCTCCAACACTTGAAGTACAAGAACGTCACTTGCTTGTTAAAGTCATTGATCGTATTCT
CTACAAATTAGACGATTTAGTCCGTCCTCATGTGCATAATATTTTGGTCGTTATTGAACC
CTTGCTTATTGATGAAGATTATTACGCTCGTGTTGAAGGTCGTGAAATTATTTCTAACTT
AGCTAAGGCTGCCGGTTTACCTACTATGATTAAAACACTCAAGCCTGATATTGACCATAA
TGATGAATTCGTACGTAATACAACAGCTCGTGCATTTGCCGTCGTCGCAAGTAGTTTAGG
TATTTCATCTATGTTACCTTTCTTAAAGCCTGTCTGCAAAAGTAAAAAAAGTTGGTACAC
CCGTCACACTGGTATTAAAATCGTTTAATAAATTGCTATCTTGATGGGTTGCGCTATTCT
TCCTCATCTTCGTTCACTTGTTGAAATTATTGAGCTTGGTTTAAAAGATGAACAAAATAA
AGTGAGAACAATTACAAGTCTTGCTCTTGCTGCCTTAGCAGAAGCTGCTACTCCTTATGG
TATCGACGCTTTTGCTAGTGTGTTAATTCCTCTTTGGGAAGGTATTACATAGTACAAGGG
TAAAAGTTTAGCTGCCTTCCTTAAGGCTATTGGCTTTATCATTCCATTGATGGATGCTGA
CAGAGCTCTCGAATACACTAAAGAAGTAATGGAAATATTGAAAAATGAATTTTCAAATCC
TGAAGAAGAAATGCGTAAAATTGTATTAAAAGTAGTAAAGTAGTGTGTTAGTTGTTAGGG
TGTTGATGCACAATACGTCCGTGAGCATGTTGTACCAAAGTTTTTTGAACAATTTTGGGT
ATCTCGTATGGCAACTGATAAGAATTCTCGTTAACTTATTGATACTACTATTGAAATTGC
TTCCAAAGTTGGAGGTGCTGAAATTCTTGAAATTATAGTTCCTCACTTAAAATCAACTAG
TGAAGCTTATCGTAAAATGGTCATGGAGACTATTGAAAAAATAGTAGCAGCCCTTGGTGT
TTCTGACGTTGATAACGCTTTAGAATAATAATTAATGGATGGTATCATCTCTGCTTTCCA
TGAACAAAATAGTGAAGATACTGGTACCATGCTTAATGGTTTCGGTACTTGTGTTAACGC
TTTAGGCTAACGTGCAAAGCCTTATTTCTCTTAAATTTGTGGTATTATATAATGGCGTCT
GAATAACAAGAGTGCTCGTGTCCGTCAATAAGCAGCTGATCTAATTTCTCGTATAGCTTC
TTGTATGAAGAATTGCAGTGAAGAGAATAGACTTGGTAATTTAGGTCTTTTGTTGTATGA
GAGTTTGGGTGAAGAATATCCTGAAGTCCTTGGTTCTATCCTTGGTGGTTTGAAAGCAAT
AGTAAATGTCATAGGTATGAATAAAATGACACCACCAATAAAAGATCTATTACCTCGTCT
TACTCCAATTTTGAAAAATAGACATGAAAAAGTTTAAGAAAACTCTATTGATTTAATAGG
TAGAATTTCAGATAGAGGAGCTGAGCATGTTTCTCCTAAAGAATGGATGCGTATATGTTT
CGATTTACTTGATCTTCTTAAGGCACATAAAAAGGGTATTCGTCGTGCTACAGTCAATAC
ATTTGGTTATATTGCTAAAGCCATCGGTCCATAGGATGTTTTGGTTACTTTATTGAATAA
CTTGAAGGTCTAAGAAAGACAACTTCGTGTTTGCACAACAGTAGCTATTGCTATCGTAGC
AGAAACATGTGGTCCCTTCACAGTCCTCCCTGCTTTGATGAATGAATATCGTGTCTAAGA
ATTGAATGTTTAAAATGGTGTATTAAAATCTTTATCATTCATGTTTGAATATATTGGAGA
AATGGCAAAGAATTATATTGCCGCTATAATTACTCTTCTAGAAGATGCCTTGGTAGATCG
TGATCCAGTTCATCGTCAAACTGCAGCCTCAGCAGTAAAACATTTAGCTCTTGGTGTTTC
CAATCTTGGATGTGAAGATTGCTTAATCCACTTACTCAACTTCATTTGGCCTAACATTTT
TGAAACATCTCCTCACGTCATCACCGCTATGACCGAAGCTATAGATGCCCTTCGTGTTGC
ATTAGGACCTGGAGTCATATTACTTTATCTTCTTTAAGGATTGTATCATCCAGCTAAAAG
AGTAATCAATTTTTTATTCAGCTTTAACATTTGAATTTAGAAAGTTTTTTGCAAATTCTT
TCTACACTCAAGAAGAATTATATTTCATTCGTTTTTTTTTTATGATATAGGTTAGACAAG
TATATTGGAAGTTGTATAACATGATATATGTTGGAAGTTAAGATGCTCTAGTTGCATTTT
TCCCAACACTTGAAGATGACGAAGGAGAAGATAGAAAACAGTATTCATACTCCAGAAATG
AACTGCAATTAATGCTCTGA