Identifiers and Description

Gene Model Identifier

TTHERM_00849220

Standard Name

PRP1 (pre-mRNA processing factor 1)

Aliases

PreTt24923 | 149.m00049 | 3750.m00279

Description

U4/U6 x U5 tri-snRNP complex subunit

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00849220

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18700.19.997093137033517e-262hypothetical protein (921 aa)
OxytrichaContig17451.0.g466.001048086731027e-152PRP1 splicing factor, N-termin
al
DictyBaseDDB_G02723749.997639769646959e-151prpf6 on chromosome: 2 positio
n 1378065 to 1381252
WormBaseWBGene000133437.000689681459392e-147locus:prp-6 status:Confirmed
UniProt:Q9GRZ2 protein_id
:CAC14407.3
SGDYBR055C7.997908857293895e-55PRP6 Splicing factor, componen
t of the U4/U6-U5 snRNP comple
x

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00849220(coding)
ATGAGTAATAAAAGCTATTACGCTAAAACTGATTTTGGTCCACCTCCTCCAAATTACGTA
GCAGGTTTGGCAAGAGGTGCAGTAGGTTTTATCACTCGTTCAGATATTGGTCCTGCAAAT
TATAGTTCTTATGATTCCTGGAGTGGTTATCAGGAAAATATATTTGCTAATGATAAATAA
GATGATGAAGATAGACAAGCAGAAGAAGAATACAACAAAATTGATAATTTTATGGCAGGT
CGTCGTATTAAATACATAGAAAAAAAATAGTAAGAGGAAGCCAAAAAAAATTTAGAAAAG
AACCCATCTGTAGCATTTTAATTCGCAGATCTTAAGCGTGATTTGGGTGGTATTACTTAT
GATGAATGGAATGCTATTCCTGAAGTCTAAGACTACACTATTAAAAAGAGTAAAAATGAA
AAATACACTCCTGTTCCAGACCATATTATTTAGAGCGCAAGATCGGAAGGTTCATTTAGC
ACTTCTTTAGATGTAACTGGTCTCCAAACTCCTCATAACATCAACGATATTGGTAAAGCC
AACTAGACTATTTTTACTTCAAGATTGGATAAATCTTCAGATCAAGTTAGTGGTATTTCT
ACAGTTGATAAGTCAGGTTACTTAACTAGTTTAAATTCATAACTTGTGAATTCTTCAGCA
GATATTGGTGATTTTAAACGTGCTCGTAATTTGATGAAGAGTTTTGTTAAAACTGATCCG
AAAAATCCAGTTGGTTGGATCAGTGTTGCTCGTGTTGAAGAGTTAGATGGTAAAATTTAG
GAAGCTCGTAATGTTCTTTATTAGGGCTTACCACACTGTGAGACATCTGATGAAATATGG
GTAGAAATAGCTCGTTTAGAAACTCCTGAAAAAGCTCGTGCTCTGCTTGCTAAAGCAGCT
ACTATACTTCCTAAGAGCTTAAAAATTTGGTTAGCAGCTGCAGATTTAGAAAGTAATCGT
GAGATGAAGGTTAAAATTTTAAAGAAAGCACTTGAACATATCCCTGATTAACCAAGACTT
TGGAAGAAGCTTATTGAATACGAAGAAAGCTAAAAGGAAGCAAAAATTCTTCTTTATAAG
GCTGTAGAATGTATTCCTGATGACTTAGATATGTGGTTAGCTCTTGCTAAACTGGAAACA
TACGAAAATGCAAAAGCTGTTTTAAATAAGGCACGTAAAATTCACCCTTAAGAATTGTCA
ATTTGGGTTAACGCTGCTAAATTAGAAGAATCTCAAGGATAACCTTAGGAAACTATCACA
AAGGTGTTATAAAATGCAATCAAATATTTTTCAAGCAAAAATATCAATATTGTAAAAGAA
GACTGGCTAAAAGAAGCAGCATACTGTGAAAAATCAGGAAATTTAAATACTTGTATAGCT
ATTGTTTAAGCTATCGTTCTTCATAACGTTCATGATAAATCTGATAAAGAACGTATCATT
AAGGAAGAAGCAAAGAATATGATTGAAGGAACTTGTATTGGAACAGGACGTGCCATTTAT
GAATTTGGTATTGAAGCACTCAAACCTGACAATATTGACCTTTTTCAAGCAACAATCGAC
TTTGAATAGAATACAGGAAAAGATAAAGATAATCTAAAACGCTTGTACAAGGAAGCTACA
ACTCAGCATCCTAAATATGAGAGTTTTTGGATTTAAAGAATCAAGTTCCATTGGTAAGAA
GCCAACAAAGTCATAGAGTAGGCATAATTATAAAATCACAGCGAAAAAAATATTGAAACT
CCATCTACAGTAGATGAAGAAGCTCAAATGAATTAATAAATTACTGCACAAAAGGCAGAA
ATATAAAAATTGCTCTAAGAATCATAAGAAAATTTACCTGAAAGCTAACAAATCCTTGTC
TTATCTATTAAATATCTTAAGAAGAATGAAGAGATAGATCAAGCAAGGGAATTAGTTTAC
AAAGCAAGAAAAAATAACCCAACACACTAAGTTTACCTTAGTCTACTTAAATTGGAATAT
TAAACAGGTGCTTTACAAAAGGCTTTCTAAGAATCTTAAAATGCAATGGGAGCATTCCCA
AATTGTGAAAAGATATTTATCTTATCTGCTAAAATAGCTTATGCTCATAAATCAATTGAA
TAAGCTCGTTAAGTCTATGAAAAAGGGCTACGTTTTAATCCCATGAGTGTTAGTTTGATT
CAAAAGTATGTAGAACTGGAAATAAATCATAAATACTTTGCTCGTGCTCGTCCTGTTCTT
GAAAAATTCCGTGTTAAGCTCCCCAAAAATCCCGAACTTTGGTGCACTGCAGTATAATTA
GAAATAGAAGCTGAAAATAAAAAAGGAGCTAGATATATGCTAGCCCGTGCTTTAAAGGAG
TGTCCTGATTATACTCAATTATGGTCTTATGCTATCGAATTAGAGCCTAAGGCTACTCGT
AAGAAAAAAACTTCTGAAGCCTTGGAAAAATGTAGATAAGATCCATATGTGAACGTTTCT
GTTGCCAAATTATTTTGGAAAGAACGTAAAATGGATAAAGCACGTAAATGGATTGAGAAA
TCAACCTTTGAAAGACCTGAAATAATGGATTCGTGGGCTGCTCTCTATCTTTTAGTATTA
GAAACTGAAGGCCGTTAATAAGCAGATGAAGTCTTAATTAAGGTTAAGCAATTAGATGTC
CATAGAGAAGGTCGTTTATACTAAAAGATAAAAAAATCAGATGACGGATGGAGATATAGC
TTCGATTAAATATTTATAAAAATAACAGATCAAATAAAAAAAGAACTAAGTAATATAGAG
TGA


>TTHERM_00849220(protein)
MSNKSYYAKTDFGPPPPNYVAGLARGAVGFITRSDIGPANYSSYDSWSGYQENIFANDKQ
DDEDRQAEEEYNKIDNFMAGRRIKYIEKKQQEEAKKNLEKNPSVAFQFADLKRDLGGITY
DEWNAIPEVQDYTIKKSKNEKYTPVPDHIIQSARSEGSFSTSLDVTGLQTPHNINDIGKA
NQTIFTSRLDKSSDQVSGISTVDKSGYLTSLNSQLVNSSADIGDFKRARNLMKSFVKTDP
KNPVGWISVARVEELDGKIQEARNVLYQGLPHCETSDEIWVEIARLETPEKARALLAKAA
TILPKSLKIWLAAADLESNREMKVKILKKALEHIPDQPRLWKKLIEYEESQKEAKILLYK
AVECIPDDLDMWLALAKLETYENAKAVLNKARKIHPQELSIWVNAAKLEESQGQPQETIT
KVLQNAIKYFSSKNINIVKEDWLKEAAYCEKSGNLNTCIAIVQAIVLHNVHDKSDKERII
KEEAKNMIEGTCIGTGRAIYEFGIEALKPDNIDLFQATIDFEQNTGKDKDNLKRLYKEAT
TQHPKYESFWIQRIKFHWQEANKVIEQAQLQNHSEKNIETPSTVDEEAQMNQQITAQKAE
IQKLLQESQENLPESQQILVLSIKYLKKNEEIDQARELVYKARKNNPTHQVYLSLLKLEY
QTGALQKAFQESQNAMGAFPNCEKIFILSAKIAYAHKSIEQARQVYEKGLRFNPMSVSLI
QKYVELEINHKYFARARPVLEKFRVKLPKNPELWCTAVQLEIEAENKKGARYMLARALKE
CPDYTQLWSYAIELEPKATRKKKTSEALEKCRQDPYVNVSVAKLFWKERKMDKARKWIEK
STFERPEIMDSWAALYLLVLETEGRQQADEVLIKVKQLDVHREGRLYQKIKKSDDGWRYS
FDQIFIKITDQIKKELSNIE


>TTHERM_00849220(gene)
ATGAGTAATAAAAGCTATTACGCTAAAACTGATTTTGGTCCACCTCCTCCAAATTACGTA
GCAGGTTTGGCAAGAGGTGCAGTAGGTTTTATCACTCGTTCAGATATTGGTCCTGCAAAT
TATAGTTCTTATGATTCCTGGAGTGGTTATCAGGAAAATATATTTGCTAATGATAAATAA
GATGATGAAGATAGACAAGCAGAAGAAGAATACAACAAAATTGATAATTTTATGGCAGGT
CGTCGTATTAAATACATAGAAAAAAAATAGTAAGAGGAAGCCAAAAAAAATTTAGAAAAG
AACCCATCTGTAGCATTTTAATTCGCAGATCTTAAGCGTGATTTGGGTGGTATTACTTAT
GATGAATGGAATGCTATTCCTGAAGTCTAAGACTACACTATTAAAAAGAGTAAAAATGAA
AAATACACTCCTGTTCCAGACCATATTATTTAGAGCGCAAGATCGGAAGGTTCATTTAGC
ACTTCTTTAGATGTAACTGGTCTCCAAACTCCTCATAACATCAACGATATTGGTAAAGCC
AACTAGACTATTTTTACTTCAAGATTGGATAAATCTTCAGATCAAGTTAGTGGTATTTCT
ACAGTTGATAAGTCAGGTTACTTAACTAGTTTAAATTCATAACTTGTGAATTCTTCAGCA
GATATTGGTGATTTTAAACGTGCTCGTAATTTGATGAAGAGTTTTGTTAAAACTGATCCG
AAAAATCCAGTTGGTTGGATCAGTGTTGCTCGTGTTGAAGAGTTAGATGGTAAAATTTAG
GAAGCTCGTAATGTTCTTTATTAGGGCTTACCACACTGTGAGACATCTGATGAAATATGG
GTAGAAATAGCTCGTTTAGAAACTCCTGAAAAAGCTCGTGCTCTGCTTGCTAAAGCAGCT
ACTATACTTCCTAAGAGCTTAAAAATTTGGTTAGCAGCTGCAGATTTAGAAAGTAATCGT
GAGATGAAGGTTAAAATTTTAAAGAAAGCACTTGAACATATCCCTGATTAACCAAGACTT
TGGAAGAAGCTTATTGAATACGAAGAAAGCTAAAAGGAAGCAAAAATTCTTCTTTATAAG
GCTGTAGAATGTATTCCTGATGACTTAGATATGTGGTTAGCTCTTGCTAAACTGGAAACA
TACGAAAATGCAAAAGCTGTTTTAAATAAGGCACGTAAAATTCACCCTTAAGAATTGTCA
ATTTGGGTTAACGCTGCTAAATTAGAAGAATCTCAAGGATAACCTTAGGAAACTATCACA
AAGGTGTTATAAAATGCAATCAAATATTTTTCAAGCAAAAATATCAATATTGTAAAAGAA
GACTGGCTAAAAGAAGCAGCATACTGTGAAAAATCAGGAAATTTAAATACTTGTATAGCT
ATTGTTTAAGCTATCGTTCTTCATAACGTTCATGATAAATCTGATAAAGAACGTATCATT
AAGGAAGAAGCAAAGAATATGATTGAAGGAACTTGTATTGGAACAGGACGTGCCATTTAT
GAATTTGGTATTGAAGCACTCAAACCTGACAATATTGACCTTTTTCAAGCAACAATCGAC
TTTGAATAGAATACAGGAAAAGATAAAGATAATCTAAAACGCTTGTACAAGGAAGCTACA
ACTCAGCATCCTAAATATGAGAGTTTTTGGATTTAAAGAATCAAGTTCCATTGGTAAGAA
GCCAACAAAGTCATAGAGTAGGCATAATTATAAAATCACAGCGAAAAAAATATTGAAACT
CCATCTACAGTAGATGAAGAAGCTCAAATGAATTAATAAATTACTGCACAAAAGGCAGAA
ATATAAAAATTGCTCTAAGAATCATAAGAAAATTTACCTGAAAGCTAACAAATCCTTGTC
TTATCTATTAAATATCTTAAGAAGAATGAAGAGATAGATCAAGCAAGGGAATTAGTTTAC
AAAGCAAGAAAAAATAACCCAACACACTAAGTTTACCTTAGTCTACTTAAATTGGAATAT
TAAACAGGTGCTTTACAAAAGGCTTTCTAAGAATCTTAAAATGCAATGGGAGCATTCCCA
AATTGTGAAAAGATATTTATCTTATCTGCTAAAATAGCTTATGCTCATAAATCAATTGAA
TAAGCTCGTTAAGTCTATGAAAAAGGGCTACGTTTTAATCCCATGAGTGTTAGTTTGATT
CAAAAGTATGTAGAACTGGAAATAAATCATAAATACTTTGCTCGTGCTCGTCCTGTTCTT
GAAAAATTCCGTGTTAAGCTCCCCAAAAATCCCGAACTTTGGTGCACTGCAGTATAATTA
GAAATAGAAGCTGAAAATAAAAAAGGAGCTAGATATATGCTAGCCCGTGCTTTAAAGGAG
TGTCCTGATTATACTCAATTATGGTCTTATGCTATCGAATTAGAGCCTAAGGCTACTCGT
AAGAAAAAAACTTCTGAAGCCTTGGAAAAATGTAGATAAGATCCATATGTGAACGTTTCT
GTTGCCAAATTATTTTGGAAAGAACGTAAAATGGATAAAGCACGTAAATGGATTGAGAAA
TCAACCTTTGAAAGACCTGAAATAATGGATTCGTGGGCTGCTCTCTATCTTTTAGTATTA
GAAACTGAAGGCCGTTAATAAGCAGATGAAGTCTTAATTAAGGTTAAGCAATTAGATGTC
CATAGAGAAGGTCGTTTATACTAAAAGATAAAAAAATCAGATGACGGATGGAGATATAGC
TTCGATTAAATATTTATAAAAATAACAGATCAAATAAAAAAAGAACTAAGTAATATAGAG
TGA