Identifiers and Description

Gene Model Identifier

TTHERM_00243710

Standard Name

PRI2 (Subunit of DNA primase. )

Aliases

PreTt02367 | 21.m00198

Description

Eukaryotic-type DNA primase, large subunit family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF04104 ) Eukaryotic-type DNA primase, large subunit

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00243710

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19453.19.997093137033517e-262eukaryotic-type DNA primase, l
arge subunit protein (501 aa)
OxytrichaContig15489.0.0.g181.999534248571833e-46Eukaryotic and archaeal DNA pr
imase, large subunit
DictyBaseDDB_G02704424.00073564232477e-35polA3 on chromosome: 1 positio
n 4882826 to 4884472
SGDYKL045W9.99893167504554e-35PRI2 Subunit of DNA primase, w
hich is required for DNA synth
esis and double-strand break r
epair
WormBaseWBGene000041814.001033848388204e-30locus:pri-2 DNA primase larg
e subunit status:Confirmed
UniProt:O02334 protein_id:C
AB03469.2
Stentor CoeruleusSteCoe_148485.74952226429356e-19

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00243710(coding)
ATGATTAATAATAAATAGATATAAAAAATATAGTAAATATCTAAATTTTAATTAAAAGAG
TATATAGAAATGTAAATGCAATAACATAGCTTAAATAAGTAAATAAAAGAAGAAGAAAGA
AATTACATTTTATTAGAAAATGCAATAGATAATTCTAATATTTAAGGGTTTTAAACAATA
TAAGAAATAGTTTAGTTAGCAATGTAGAGAATGAAAATGATCAAAGAAATAATCTAAGAA
GAACCTAGATTCAATCTTATTGATCCTCTTAGCAAGCCAAATTATAATAGAATTAGAGTA
GCCAACAAATTTATTACAGTAGCTATACCCAAAAGTGATCCTGAATATGAGTTAAAGAAT
AAACAACAATATGCAAAAGAAGTACTTTCACATTTCCTTTGTAAAATGGCTTACGCTTTT
TATGCAGAACCAGAAACATGGCTTGAATTTGCAAGAGCAGAGGCTTTTATTTTAATGGAT
AAGCTTAAATCTGGTTAGCACCATGCAAACTTCTTTTCAGATGAGAATCTTAAAATAAAA
ACCATTTCTGACGAATTATTCAAACAAGCATTTCCTAAGATAGAAGCCACATTTAGCAGC
ATAAAGATTAAGAAAAATGATTCAGAAGTAGAGCAAATTAATATAAAGAAAGATAATTTC
AAAATGTTCAAATTTATAGATCACCCTTCAATGCTTTCAAATAATGATGTTGTTTTACAC
AAAGGATATATTATTATTTATAAGGAATCAACTTCTAAAATAGTTCAAAATATTTTTATA
GAGCGCTTATTAGATGAAATGAGATTGCTTTAGCTAAAGTTTTAAAATAATGGAAGCAAA
TTAGATGATGATAGACTATCATTTTTAAAAGATTTACACAAAGCAGAAATATTTAACGAT
TCAACATAATTTAATTCAACTTAAATTCATCACTACGAGCTTGATAGGCTAGCTAAAAGA
GATATGCCAGCTTGTATGACCTATCTTATGTATGGTTTAAATTAAAAACTCCATTTAAAA
CATTTTGGTAGACTTTAGCTTGGTTTATTCTTGAAAGGTGCAGGACTTAGCTTAAATGAA
GCTTTAACATTTTGGCAAAAAAAATTCTCTAAAACAAGTGCTGATGACTTTAAAAAGAAG
TATGACTATAACATTAGACACAATTACGGTAAATTAGGTAAATAGCTTGATTACACACCA
ATGAGTTGTTAGAAAATAATTGGTTTCTAGCCTTTAAAAGATGAATTCCATGGATGTCCT
TACAAAACTATGGAAAGTTAATAATTAAAAGATTTCTTAAAATTAAGTTACAACATAACC
GATGAATAATTCGTTTAAGTGAACATATTTAAAAACCAAAAGCAATACCAACTTGCTTGT
AAAGAAGTATTTAAGGTTTTGAATGATACTAGAGATAAAACTAAAGAATAATTCTATCCT
TACTTTGATAAAGTTGGTAACCATCCTAATGCATATTTTGAATAATCTTTACGTATGCAT
GAACCACAGCGTTTCTAAAAATAAGATGAAGAAAAAAAATAAAATAAATAAAATAGAAAT
CAGAATTTTTCAGCAAATAAATAAAGTACAAATAAAAACAATTAAATGGATTTGGAATTT
TGA


>TTHERM_00243710(protein)
MINNKQIQKIQQISKFQLKEYIEMQMQQHSLNKQIKEEERNYILLENAIDNSNIQGFQTI
QEIVQLAMQRMKMIKEIIQEEPRFNLIDPLSKPNYNRIRVANKFITVAIPKSDPEYELKN
KQQYAKEVLSHFLCKMAYAFYAEPETWLEFARAEAFILMDKLKSGQHHANFFSDENLKIK
TISDELFKQAFPKIEATFSSIKIKKNDSEVEQINIKKDNFKMFKFIDHPSMLSNNDVVLH
KGYIIIYKESTSKIVQNIFIERLLDEMRLLQLKFQNNGSKLDDDRLSFLKDLHKAEIFND
STQFNSTQIHHYELDRLAKRDMPACMTYLMYGLNQKLHLKHFGRLQLGLFLKGAGLSLNE
ALTFWQKKFSKTSADDFKKKYDYNIRHNYGKLGKQLDYTPMSCQKIIGFQPLKDEFHGCP
YKTMESQQLKDFLKLSYNITDEQFVQVNIFKNQKQYQLACKEVFKVLNDTRDKTKEQFYP
YFDKVGNHPNAYFEQSLRMHEPQRFQKQDEEKKQNKQNRNQNFSANKQSTNKNNQMDLEF


>TTHERM_00243710(gene)
ATGATTAATAATAAATAGATATAAAAAATATAGTAAATATCTAAATTTTAATTAAAAGAG
TATATAGAAATGTAAATGCAATAACATAGCTTAAATAAGTAAATAAAAGAAGAAGAAAGA
AATTACATTTTATTAGAAAATGCAATAGATAATTCTAATATTTAAGGGTTTTAAACAATA
TAAGAAATAGTTTAGTTAGCAATGTAGAGAATGAAAATGATCAAAGAAATAATCTAAGAG
TAATTAAATATATTCATTCCTTATTTTTGATGATCATTTCTACTTAAGCAACCTTTATTT
ATTTAACAATTATCTATCTAAATAGAGAACCTAGATTCAATCTTATTGATCCTCTTAGCA
AGCCAAATTATAATAGAATTAGAGTAGCCAACAAATTTATTACAGTAGCTATACCCAAAA
GTGATCCTGAATATGAGTTAAAGAATAAACAACAATATGCAAAAGAAGTACTTTCACATT
TCCTTTGTAAAATGGCTTACGCTTTTTATGCAGAACCAGAAACATGGCTTGAATTTGCAA
GAGCAGAGGCTTTTATTTTAATGGATAAGCTTAAATCTGGTTAGCACCATGCAAACTTCT
TTTCAGATGAGAATCTTAAAATAAAAACCATTTCTGACGAATTATTCAAACAAGCATTTC
CTAAGATAGAAGCCACATTTAGCAGCATAAAGATTAAGAAAAATGATTCAGAAGTAGAGC
AAATTAATATAAAGAAAGATAATTTCAAAATGGTAATAAACTACAATAAATAAATTTGAT
TTTTATATTTTGTTTAAAATTAGTTCAAATTTATAGATCACCCTTCAATGCTTTCAAATA
ATGATGTTGTTTTACACAAAGGATATATTATTATTTATAAGGAATCAACTTCTAAAATAG
TTCAAAATATTTTTATAGAGCGCTTATTAGATGAAATGAGATGTAATTAATTAATTTCAA
CAATTAAAATTTTCATCAACTTATTTTGAAAATTTTGTTTTGAGTTTGATTTATTAAAAA
TTCGTTTAATATAATTAGTGCTTTAGCTAAAGTTTTAAAATAATGGAAGCAAATTAGATG
ATGATAGACTATCATTTTTAAAAGATTTACACAAAGCAGAAATATTTAACGATTCAACAT
AATTTAATTCAACTTAAATTCATCACTACGAGCTTGATAGGCTAGCTAAAAGGTTTTCTT
TTTAAATTTAAAGGAGAAAATTGAATTGTTTAATTTTAGAAAAATGAAAAAAAAAAAAAT
TTATAATTTTTTAAAATTTAAAATAGAGATATGCCAGCTTGTATGACCTATCTTATGTAT
GGTTTAAATTAAAAACTCCATTTAAAACATTTTGGTAGACTTTAGCTTGGTTTATTCTTG
AAAGGTGCAGGACTTAGCTTAAATGAAGCTTTAACATTTTGGCAAAAAAAATTCTCTAAA
ACAAGTGCTGATGACTTTAAAAAGAAGTATGACTATAACATTAGACACAATTACGGTAAA
TTAGGTAAATAGCTTGATTACACACCAATGAGTTGTTAGAAAATAATTGGTTTCTAGCCT
TTAAAAGATGAATTCCATGGATGTCCTTACAAAACTATGGAAAGTTAATAATTAAAAGAT
TTCTTAAAATTAAGTTACAACATAACCGATGAATAATTCGTTTAAGTGAACATATTTAAA
AACCAAAAGCAATACCAAGTAATTTTAGCTTTATTTAATCTTTTTTATTAATTTATTTTA
ATAAATGAATTAGCTTGCTTGTAAAGAAGTATTTAAGGTTTTGAATGATACTAGAGATAA
AACTAAAGAATAATTCTATCCTTACTTTGATAAAGTTGGTAACCATCCTAATGCATATTT
TGAATAATCTTTACGTATGCATGAACCACAGCGTTTCTAAAAATAAGATGAAGAAAAAAA
ATAAAATAAATAAAATAGAAATCAGAATTTTTCAGCAAATAAATAAAGTACAAATAAAAA
CAATTAAATGGATTTGGAATTTTGA