Identifiers and Description

Gene Model Identifier

TTHERM_00571880

Standard Name

PRI1 (Subunit of DNA primase. )

Aliases

PreTt10518 | 76.m00220 | 3810.m02077

Description

DNA primase, eukaryotic-type, small subunit, putative family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00571880

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03423.19.997093137033517e-262DNA primase, eukaryotic-type,
small subunit, family protein
(397 aa)
OxytrichaContig14240.0.g632.9986068920536807e-84Eukaryotic and archaeal DNA pr
imase small subunit
WormBaseWBGene000041801.9998099689916736e-77locus:pri-1 DNA primase smal
l subunit status:Confirmed
UniProt:P34471 protein_id:C
AA80161.1
SGDYIR008C6.002203762674495e-72PRI1 Subunit of DNA primase, w
hich is required for DNA synth
esis and double-strand break r
epair
DictyBaseDDB_G02858531.0000844672813518e-48polA4 on chromosome: 4 positio
n 3724070 to 3725418

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00571880(coding)
ATGGAAATAGAAACAGTTGAAGTTGCACCTTAATAGGAAGAAGAATTTAAGTTAGATTAT
GATTTATTAGAGGAATATTACAGAAGTTATTTCCCTGTAAGTTAAATGGTTTAATGGCTT
TCTTATCCTCAAGATGGCGATGACACATACTTCACTAGAAGAGAATTTTCATTCACTTTG
TAAAATGAAGTGTATCTAAGATATTAAATGTATAACAGTGAAAGAGAATTTAAAAACGCT
TTGCTATAAAAAGTTCCTGAAAAAATTGATATTGGAGCTGTCTATGATAGACCTGGAAAA
AAAGGAGACGATATTAAAGCAAAAGAGAAGGAATTCGTTATTGATATTGATATGACAGAT
TACGATCATATTAGAACTTGTTGCTCAAAAGCAAAAATTTGTGAAAAATGCTGGAAATTT
ATGAGAGTAGCTTGTGATTTAATTTCTAAAAGCTTAGATGAAGATTTTGGTTTTTAACAT
GTTTTATGGGTCTACTCTGGTAGAAGAGGTATTCATGCTTGGGTATGTGATAAAGAAATA
AGAAAGGCAAACGATTATACTAGAGCATCTATAATAGATTATTTGAATATTTTAGTTGAT
AATTCAATTGGCTCTTCCTATGTAAAGCCATCCCTATTAAAAATGGAAAAAAGTCATCTC
ATCGAAAGGAATGCAATGAAATAATTGAACTAAAAAAATGATGATTTAAAAGCTGAAAAA
GAAAGTGAAAAAGTATTTGTAGAAATAGTTTTAAGAGAGCAAAATTTATTTATGAAAAAA
CCAGAAATCATATTAGAATTTTTGGCAAAAAGAAGTGAAAATCTCTCTAAAGAAGTTGAA
AAAGAATGGAAAACATTGAAAACATCCGAATAAAGATATGAAGCTTTAAAGGAATTAGTT
AGCAGCGAAGACAAGAAAAAGACTCACTACCTCCTTGAAGAACTTAGAATTTGGCTTCTT
TATCCTCGTTTGGACGTCAATGTCTCAAAATCAACTAATCACTTGTTAAAATCTCCCTTC
TGTATCCATCCAAAAACAGGAAACGTATGTGTTCCTTTTACAACTGAAGAAATTAGCACT
TTTGATCCTTTTTCAGTGCCTAACATTTCAACTTTAACTACTGAAGAAGGAAGCAGTAAA
ATGAAAAACTCACTCAAAATATTCAATAAATTTTTAGAAAATTTGAAAAAAGATGTTTGA


>TTHERM_00571880(protein)
MEIETVEVAPQQEEEFKLDYDLLEEYYRSYFPVSQMVQWLSYPQDGDDTYFTRREFSFTL
QNEVYLRYQMYNSEREFKNALLQKVPEKIDIGAVYDRPGKKGDDIKAKEKEFVIDIDMTD
YDHIRTCCSKAKICEKCWKFMRVACDLISKSLDEDFGFQHVLWVYSGRRGIHAWVCDKEI
RKANDYTRASIIDYLNILVDNSIGSSYVKPSLLKMEKSHLIERNAMKQLNQKNDDLKAEK
ESEKVFVEIVLREQNLFMKKPEIILEFLAKRSENLSKEVEKEWKTLKTSEQRYEALKELV
SSEDKKKTHYLLEELRIWLLYPRLDVNVSKSTNHLLKSPFCIHPKTGNVCVPFTTEEIST
FDPFSVPNISTLTTEEGSSKMKNSLKIFNKFLENLKKDV


>TTHERM_00571880(gene)
ATGGAAATAGAAACAGTTGAAGTTGCACCTTAATAGGAAGAAGAATTTAAGTTAGATTAT
GATTTATTAGAGGAATATTACAGAAGTTATTTCCCTGTAAGTTAAATGGTTTAATGGCTT
TCTTATCCTCAAGGTACATTATTGAAGCATAAAATTAATTAATATTATATGTTTTTTTTT
TTTGATTTATTAGATGGCGATGACACATACTTCACTAGAAGAGAATTTTCATTCACTTTG
TAAAATGAAGTGTATCTAAGATATTAAATGTATAACAGTGAAAGAGAATTTAAAAACGCT
TTGCTATAAAAAGTTCCTGAAAAAATTGATATTGGAGCTGTCTATGATAGACCTGTAAAT
ATTAATAAAATTAATGAATTAAATTGACATATTAATAATATTTCAAATTAGGGAAAAAAA
GGAGACGATATTAAAGCAAAAGAGAAGGTATATTAAATATTTAATAGGAAATAGAATGTA
AAACACATGCGAAATTTATTAATTTTAGGAATTCGTTATTGATATTGATATGACAGATTA
CGATCATATTAGAACTTGTTGCTCAAAAGCAAAAATTTGTGAAAAATGCTGGAAATTTAT
GAGAGTAGCTTGTGATTTAATTTCTAAAAGCTTAGATGAAGATTTTGGTTTTTAACATGT
TTTATGGGTCTACTCTGGTAGAAGAGGTATTCATGCTTGGGTATGTGATAAAGAAATAAG
AAAGGCAAACGATTATACTAGAGCATCTATAATAGATTATTTGAATATTTTAGTTGTAAG
TTAATTCTAATATCATTTTACATTATTTTATTTAAATTAAAAAAAGGATAATTCAATTGG
CTCTTCCTATGTAAAGCCATCCCTATTAAAAATGGAAAAAAGTCATCTCATCGAAAGGAA
TGCAATGAAATAATTGAACTAAAAAAATGATGATTTAAAAGCTGAAAAAGAAAGTGAAAA
AGTATTTGTAGAAATAGTTTTAAGAGAGCAAAATTTATTTATGAAAAAACCAGAAATCAT
ATTAGAATTTTTGGCAAAAAGAAGTGAAAGTATTTTAATTTTGTTTGAATATAATAAGAA
AATAGCAAATAATTTTTATTTACTTATTTATTTATTATAAAAGATCTCTCTAAAGAAGTT
GAAAAAGAATGGAAAACATTGAAAACATCCGAATAAAGATATGAAGCTTTAAAGGAATTA
GTTAGCAGCGAAGACAAGTAATTTAGTTATTTTAATAAAAAATTAAACTTTTTAAAATAA
TTAAAATAGGAAAAAGACTCACTACCTCCTTGAAGAACTTAGAATTTGGCTTCTTTATCC
TCGTTTGGACGTCAATGTCTCAAAATCAACTAATCACTTGTTAAAATCTCCCTTCTGTAT
CCATCCAAAAACAGGAAACGTATGTGTTCCTTTTACAACTGAAGAAATTAGCACTTTTGA
TCCTTTTTCAGTGCCTAACATTTCAACTTTAACTACTGAAGAAGGTAAAAAAACATATAT
TTGAAAAAAATGATTTCAACTAATCTATTTAATGTTAATAAAAATTTATTTAAAATAAAC
AGGAAGCAGTAAAATGAAAAACTCACTCAAAATATTCAATAAATTTTTAGAAAATTTGAA
AAAAGATGTTTGA