Identifiers and Description

Gene Model Identifier

TTHERM_00105430

Standard Name

PRF1 (PRoFilin)

Aliases

PreTt23043 | 7.m00567

Description

Profilin family protein; both inhibits and enhances actin polymerization; co-localizes with actin in the division furrow

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00105430

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00377.13.999498296699862e-96profilin family protein (153 a
a)
OxytrichaContig22514.0.g159.995317835403734e-19Profilin
WormBaseWBGene000039900.0000000400154582995175locus:pfn-2 Profilin-2 sta
tus:Confirmed UniProt:Q20025
protein_id:CCD62785.1
DictyBaseDDB_G02711420.00000009004106436083642proC on chromosome: 2 position
57583 to 57963
SGDYOR122C0.00003998524687536623PFY1 Profilin, binds actin, ph
osphatidylinositol 4,5-bisphos
phate, and polyproline regions
; involved in cytoskeleton org
anization; required for normal
timing of actin polymerizatio
n in response to thermal stres
s

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:15132168: Wilkes DE, Otto JJ (2004) Profilin functions in cytokinesis, nuclear positioning, and stomatogenesis in Tetrahymena thermophila. The Journal of eukaryotic microbiology 50(4):252-62
  2. Ref:11942614: Numata O, Gonda K (2001) Determination of division plane and organization of contractile ring in Tetrahymena. Cell structure and function 26(6):593-601
  3. Ref:10767551: Wilkes DE, Otto JJ (2000) Molecular cloning of profilin from Tetrahymena thermophila. Gene 246(1-2):295-301
  4. Ref:1478923: Edamatsu M, Hirono M, Watanabe Y (1992) Tetrahymena profilin is localized in the division furrow. Journal of biochemistry 112(5):637-42
  5. Ref:1902095: Edamatsu M, Hirono M, Takemasa T, Watanabe Y (1991) The primary structure of Tetrahymena profilin. Biochemical and biophysical research communications 175(2):543-50
  6. Ref:2383275: Edamatsu M, Hirono M, Watanabe Y (1990) Purification and characterization of Tetrahymena profilin. Biochemical and biophysical research communications 170(2):957-62

Sequences

>TTHERM_00105430(coding)
ATGTCTGGTTGGGATCAATATATCTAATATCTTTTGGCTGATAAGAAGTGCGAATCTGCC
TACATCCTCGGTAAGGATCATGCTAACATTTGGGCTTGCTCTACTGGTATTGCTGCTCTT
CCTACTTACTAAATCAATGTCGAAGGTAAAAACTTCAATGTTAACGAAGCTGAGCTCTTG
GTTAAGGCTTTGAAGAACAACGGTGTTCCCACTGATCCTAATGTTGGTTTAAGAATTAAG
AATGAAAAGTACTACACTGTCAGATTCGACGCTGATGCTGGTACCTGGTATCTTAAGAAG
GATTAAGGTGGTGCTTGCATTGCCGTTACCAAGTAAGCTTTAGTTATTGGTACTTTCAAA
AACGACATCAAAATGACTAACGGTCAACCTCAAAATCCTGGTGCCGTCAACGCTGCTTGT
GAAAAGCTCGCTGAATCCTTAAAGTCCGCTAACTACTGA


>TTHERM_00105430(protein)
MSGWDQYIQYLLADKKCESAYILGKDHANIWACSTGIAALPTYQINVEGKNFNVNEAELL
VKALKNNGVPTDPNVGLRIKNEKYYTVRFDADAGTWYLKKDQGGACIAVTKQALVIGTFK
NDIKMTNGQPQNPGAVNAACEKLAESLKSANY


>TTHERM_00105430(gene)
ATGTCTGGTTGGGATCAATATATCTAATATCTTTTGGCTGATAAGAAGTGCGAATCTGCC
TACATCCTCGGTAAGGATCATGCTAACATTTGGGCTTGCTCTACTGGTATTGCTGCTGTA
AGATATATTAGATTTTGCTTCTTTTTGGCCTTTTTTGCCATTTTAGTCACTCTATGATTT
TGTGACTTCAATATTAATTTCATGTATTAATTTTCCTTTTTACTAAACAATCTAGCTTCC
TACTTACTAAATCAATGTCGAAGGTAAAAACTTCAATGTTAACGAAGCTGAGCTCTTGGT
TAAGGGTAATTTTTCTTTTAATTCATTAACTATCTCATATAATTGGCTGATTATCTTCAA
GCTTCTTCTCTCAAAAACTCTTTCATTCCTATGAAAATTATTAGTGTTTAATATTTTTAA
GATCCGAAGAACAATAAATAAATAAATAATATCCTTCGAACAAAAATTAGCAAACCTTCA
AATCATTTAATCAATAAATAAATAAATATATAAGTACATAGCAACTATGCAACTAACTAA
TAAGGAATGAAGTACTCAATTTTTAACAAATATTTGCCAATATTCATCAAATTTTGATTA
GCTTTCCTCTTTAATATTTACTAATATTAATAATAATATTCTCTTTCGTTAAATATTTTA
GCTTTGAAGAACAACGGTGTTCCCACTGATCCTAATGTTGGTTTAAGAATTAAGAATGAA
AAGTACTACACTGTCAGATTCGACGCTGATGCTGGTACCTGGTATCTTAAGAAGGTATAT
AATTTATTATTATTTAAGTTAGCAAATTATTCAAAGCTATAGCTATTAGGTGTCTTAAAA
AAATAAACTAGCCAGCCATTTATTTATAATATTTGTTTTCATGACTGATATTAAGATATT
TTAGAAAATAAAGCACCAAGCACTCAAAAAATAAAATAATGCAAAAATTAATATTATTTT
TCAAAAAATAATTTAGGATTAAGGTGGTGCTTGCATTGCCGTTACCAAGTAAGCTTTAGT
TATTGGTACTTTCAAAAACGACATCAAAATGACTAACGGTCAACCTCAAAATCCTGGTGC
CGTCAACGCTGCTTGTGAAAAGCTCGCTGAATCCTTAAAGTCCGCTAACTACTGA