Identifiers and Description

Gene Model Identifier

TTHERM_01050690

Standard Name

PRE8 (20S proteasome core alpha subunit 2)

Aliases

PreTt27812 | 212.m00070

Description

20S proteasome core alpha subunit 2

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • proteolysis involved in cellular protein catabolic process (IEA) | GO:0051603

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_01050690

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01450.14.000387670137323e-175proteasome A-type and B-type f
amily protein (249 aa)
DictyBaseDDB_G02809696.998089991989877e-78psmA4 on chromosome: 3 positio
n 4147505 to 4148552
SGDYGR135W6.99980278126514e-75PRE9 Alpha 3 subunit of the 20
S proteasome, the only nonesse
ntial 20S subunit; may be repl
aced by the alpha 4 subunit (P
re6p) under stress conditions
to create a more active protea
somal isoform
WormBaseWBGene000039246.001182358613152e-70locus:pas-3 Proteasome subun
it alpha type-4 status:Confi
rmed UniProt:Q9N599 protei
n_id:CCD66205.1
OxytrichaContig21162.0.g426.9991332754409754e-68Proteasome subunit
Stentor CoeruleusSteCoe_238771.6458114310822737e-38

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01050690(coding)
ATGTCAAGAAGATACGATTAGAAGACTACTACATTTACTAATGATGGTAAATTATTGTAA
GTTTAATATGCTATTGAAGCTATTAACAAAACTGGCAGTGCTATTGGTATTTTAACAAAG
GAAGGTATTGTTTTAACTACTGAGCGTTAGGACGTAAGCTCTCTTTTGGAAGCTCCTACT
CATTCCGAAAAGATTTTCTAGTTAGATTCTCATTTGTACTCCGTTGTCAACGGTTTAACC
GCTGATGCAAATTACTTGATCGACATTGCTAGAGTCGAAGCATAAAACTACAAATATCAT
TATGGTGGTGAAAATATCCCCATCGAATAGCTCATCGTTAAGATCTGCGATATTAAGTAA
TCTTATACTCAAATTGGAGGTTTGAGACCTTTCGGTGCAGCCTTCCTTTTCGCTGGTCAC
GACCGTCATTTAGGATATCAACTCTATTCTACTGATCCCTCTGGTAATTATTTCGGCTGG
AAAGCTATCGCCATCGGTCAAAAGAATGCTGAAGCCAACGGTTTACTCAAGCCATCTTAT
AAAGTTGATATCACCCTTGAGGAAGGTATCAACTTAGGTATCAAGGCCCTTGTTAAAACT
ATGGATACCGCTAATCCCTCTCCTAAAAAGATTGAAATGGTTGTTATTAGCGAAAACAAA
ACCTCTAAAAAAATAGAAGGACGTACCCTCAAAGAAGCTGAAATCAGAGCTCTTTTAGAA
AAAAATGGTTTCAATGCTGAAAAGTGA


>TTHERM_01050690(protein)
MSRRYDQKTTTFTNDGKLLQVQYAIEAINKTGSAIGILTKEGIVLTTERQDVSSLLEAPT
HSEKIFQLDSHLYSVVNGLTADANYLIDIARVEAQNYKYHYGGENIPIEQLIVKICDIKQ
SYTQIGGLRPFGAAFLFAGHDRHLGYQLYSTDPSGNYFGWKAIAIGQKNAEANGLLKPSY
KVDITLEEGINLGIKALVKTMDTANPSPKKIEMVVISENKTSKKIEGRTLKEAEIRALLE
KNGFNAEK


>TTHERM_01050690(gene)
ATGTCAAGAAGATACGATTAGAAGACTACTACATTTACTAATGATGGTAAATTATTGTAA
GTTTAATATGCTATTGAAGCTATTAACAAAACTGGCAGTGCTATTGGTATTTTAACAAAG
GAAGGTATTGTTTTAACTACTGAGCGTTAGGACGTAAGCTCTCTTTTGGAAGCTCCTACT
CATTCCGAAAAGATTTTCTAGTTAGATTCTCATTTGTACTCCGTTGTCAACGGTTTAACC
GCTGATGCAAATTACTTGATCGACATTGCTAGAGTCGAAGCATAAAACTACAAATATCAT
TATGGTGGTGAAAATATCCCCATCGAATAGCTCATCGTTAAGATCTGCGATATTAAGTAA
TCTTATACTCAAATTGGAGGTTTGAGACCTTTCGGTGCAGCCTTCCTTTTCGCTGGTCAC
GACCGTCATTTAGGATATCAACTCTATTCTACTGATCCCTCTGGTAATTATTTCGGCTGG
AAAGCTATCGCCATCGGTCAAAAGAATGCTGAAGCCAACGGTTTACTCAAGCCATCTTAT
AAAGTTGATATCACCCTTGAGGAAGGTATCAACTTAGGTATCAAGGCCCTTGTTAAAACT
ATGGATACCGCTAATCCCTCTCCTAAAAAGATTGAAATGGTTGTTATTAGCGAAAACAAA
ACCTCTAAAAAAATAGAAGGACGTACCCTCAAAGAAGCTGAAATCAGAGCTCTTTTAGAA
AAAAATGGTTTCAATGCTGAAAAGTGA