Identifiers and Description

Gene Model Identifier

TTHERM_00470650

Standard Name

PRE7 (20S proteasome core beta subunit 6)

Aliases

PreTt22479 | 56.m00183 | 3686.m00026

Description

20S proteasome core beta subunit 6

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • proteolysis involved in cellular protein catabolic process (IEA) | GO:0051603

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00470650

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11376.12.0006373583905387e-170proteasome A-type and B-type f
amily protein (248 aa)
DictyBaseDDB_G02729695.000412888119721e-59psmB1 on chromosome: 2 positio
n 1952612 to 1953771
OxytrichaContig7433.0.g811.0003503620230312e-57Proteasome subunit
WormBaseWBGene000039529.996696112986116e-50locus:pbs-6 Proteasome subun
it beta type-1 status:Confir
med UniProt:P34286 protein
_id:CCD62635.1
SGDYBL041W2.9993743585281133e-40PRE7 Beta 6 subunit of the 20S
proteasome
Stentor CoeruleusSteCoe_124636.47023492564546e-26

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00470650(coding)
ATGAATTTCCCAATATACTCATTCCCTAACGATTTGGTTAGCCACTTATCCAAGGAATAC
AAATAGCCATAAGCAGACAATATCAAGGAAGCAAAAAGAAACGAATTTAATCCCTACGTA
TTTAATGCAGGAACAGTTTGTGCTATTGCTCATGGTGATTTCGTAATTGTAGCTGGTGAT
AAAAGAATTTCTCAAGGTTACTCCATAGTTAGCAGAGATATTTCAAAGTTAGCAAGATTG
ACTGATAACGTCTTTTTAGCAACTTCTGGTATGTATGCTGACTTTGCAGCCTTATCTAAG
TAACTCTCAGCACGTTTACATATGTACAAATATAACAATGGTAAACAAGCAAATATGAGA
GCTATTGCAAGCTTGTTATCAAGAACTCTTTACTACAAGAGATTCTTCCCTTATTATACT
TTCAATCTCTTAGCTGGTTTTGATGATAAAGGTGAAGGTTTAGTAATTAACTACGATGCA
GTAGGATCTGGTGATTTTAAAAAGTACGCCGTCTTGGGATCTGGTGCTCAATTAATTACT
CCAGTCTTCGATTAGTACTTCGAAGGATACAATAAAATTAAAAAGGAATAACTTCACACT
GTTGAAGAATTCATTAGCTTTATTGTCGATTGCTTTGAATCAGCTACTGAAAGAGATATT
TATACAGGTGATTAACTTGAAATTGTCATTCTTAGAAAAGATAAAGCACCTGAATATTAA
TTGTTCCCTTTAAGAAAAGATTGA


>TTHERM_00470650(protein)
MNFPIYSFPNDLVSHLSKEYKQPQADNIKEAKRNEFNPYVFNAGTVCAIAHGDFVIVAGD
KRISQGYSIVSRDISKLARLTDNVFLATSGMYADFAALSKQLSARLHMYKYNNGKQANMR
AIASLLSRTLYYKRFFPYYTFNLLAGFDDKGEGLVINYDAVGSGDFKKYAVLGSGAQLIT
PVFDQYFEGYNKIKKEQLHTVEEFISFIVDCFESATERDIYTGDQLEIVILRKDKAPEYQ
LFPLRKD


>TTHERM_00470650(gene)
ATGAATTTCCCAATATACTCATTCCCTAACGATTTGGTTAGCCACTTATCCAAGGAATAC
AAATAGCCATAAGCAGACAATATCAAGGAAGCAAAAAGAAACGAATTTAATCCCTACGTA
TTTAATGCAGGAACAGTTTGTGGTAGAATTTTTACTCTTTTTAAAGGCGATTGGAACATT
TTAATGATGTAATTCATAATGTCATGTTAAAAATAATATTAATGGAATTTCAAAATACTC
TTGCAATCCATCGCCATAAACAGGTTTTCTCTAAGCTACAGATATTAATATATTTATTTA
TATAAAAGCTATTGCTCATGGTGATTTCGTAATTGTAGCTGGTGATAAAAGAATTTCTCA
AGGTTACTCCATAGTTAGCAGAGATATTTCAAAGTTAGCAAGATTGACTGATAACGTCTT
TTTAGCAACTTCTGGTATGTATGCTGACTTTGCAGCCTTATCTAAGTAACTCTCAGCACG
TTTACATATGTACAAATATAACAATGGTAAACAAGCAAATATGAGAGCTATTGCAAGCTT
GTTATCAAGAACTCTTTACTACAAGAGGTATTTAGATTATCTTTAATTGCTTTAAAACTA
TTTGAAAATAACACAAGAAATATATAAAGAAAGAATAAATAATTTACACTTAGATAATTG
GATTAAATAAAATTATTTTTGAATTTATAACTATCAAATATAAAAATCATTCTTTATAAT
AATAGATTCTTCCCTTATTATACTTTCAATCTCTTAGCTGGTTTTGATGATAAAGGTGAA
GGTTTAGTAATTAACTACGATGCAGTAGGATCTGGTGATTTTAAAAAGTACGCCGTCTTG
GGATCTGGTGCTCAATTAATTACTCCAGTCTTCGATTAGTACTTCGAAGGTAAGAAAGAT
AAATCCTAAATTATTGCTTCTTTAAATATTAAAAAAATAGTTTATTTAATAAAAAATAAA
TAAATAATTTATTTATTTATTAGAATTAAATTATCTGTTGAAAAGTTTTATGAATGAGTG
AAATAATGAATTGGTTGATTATTTTATTTTATTTTAATAGGATACAATAAAATTAAAAAG
GAATAACTTCACACTGTTGAAGAATTCATTAGCTTTATTGTCGATTGCTTTGAATCAGCT
ACTGAAAGAGATATTTATACAGGTAAATAGTTATTACATTTAACAAGAAATAGCAATAAT
TTTGTAACAATATAGGTGATTAACTTGAAATTGTCATTCTTAGAAAAGATAAAGCACCTG
AATATTAATTGTTCCCTTTAAGAAAAGATTGA