Identifiers and Description

Gene Model Identifier

TTHERM_00666560

Standard Name

PRE6 (20S proteasome core alpha subunit 4)

Aliases

PreTt23909 | 99.m00150

Description

20S proteasome core alpha subunit 4

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • proteolysis involved in cellular protein catabolic process (IEA) | GO:0051603

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00666560

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16567.14.99758727525843e-164proteasome subunit alpha type
7-like (243 aa)
DictyBaseDDB_G02728316.997568408582301e-83psmA7 on chromosome: 2 positio
n 2102038 to 2102926
WormBaseWBGene000039251.999129405549486e-73locus:pas-4 Proteasome subun
it alpha type-7 status:Confi
rmed UniProt:Q95005 protei
n_id:CAB02269.1
SGDYOL038W9.999565105288807e-71PRE6 Alpha 4 subunit of the 20
S proteasome; may replace alph
a 3 subunit (Pre9p) under stre
ss conditions to create a more
active proteasomal isoform; G
FP-fusion protein relocates fr
om cytosol to the mitochondria
l surface upon oxidative stres
s
OxytrichaContig13605.0.g115.997672135862771e-69Proteasome subunit
Stentor CoeruleusSteCoe_8161.3336148155022614e-34

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00666560(coding)
ATGTCTTACGATACTGCAATTACAGTTTTTGGTAAAATAGGTAACTTGTTCTAGGTTGAA
TATGCTATGGCTGCAGTCAACTAGGGTTTATGTTCAATCGGTATTAGAGGTACTGATTGC
ATAGTCATGGGTGTTGAAAAGAACCCAACCACAATTTTGTAAGAAACCAGAACCATTCGT
AAGGTTTAACGTTTGGATGACGCTACTTGCATCTGCTACTCTGGTTTGACTCCTGATGCT
CGTATTCTTACCAACATTGCAAAAGTAGAATGTTAAAGCTATAGTTTGAATTACGATGAT
AGGGTTCCGATCAATTATATTGCAAGATATATTGCTAGTGTTTAGTAAAAGTATACATAA
AAGAGTGGTGCAAGACCATTCGGTATCTCTACCCTTGTAGGTGGTTTCGATAGCAAGGGA
CAACCTCGTTTATTCTAGACAGATCCCAGTGGTGCTTGCACTGAATGGAAGGCTGTCGCA
TTAGGAAAGCACAGAAAGACTGTTATGGAAAACCTTGAAAAGAATTACTAAGAAGAGTAC
TTAGCCGAAGAAAAGTGTCTTGAATTAGCCTGCCGTGTCCTCTTAGAAGTTGTTTAAAGT
GGTTGCAAGAATATTGAATTAGTTGTTCTCAAATAAAAAGTTGAAGGAGATAAGAAAGTT
TATGAATACAGCATGATTTCTGAAGAAAAAACAATGGCTCTTATTGAAGCAGTTGATGGC
AAAAAGTGA


>TTHERM_00666560(protein)
MSYDTAITVFGKIGNLFQVEYAMAAVNQGLCSIGIRGTDCIVMGVEKNPTTILQETRTIR
KVQRLDDATCICYSGLTPDARILTNIAKVECQSYSLNYDDRVPINYIARYIASVQQKYTQ
KSGARPFGISTLVGGFDSKGQPRLFQTDPSGACTEWKAVALGKHRKTVMENLEKNYQEEY
LAEEKCLELACRVLLEVVQSGCKNIELVVLKQKVEGDKKVYEYSMISEEKTMALIEAVDG
KK


>TTHERM_00666560(gene)
ATGTCTTACGATACTGCAATTACAGTTTTTGGTAAAATAGGTAACTTGTTCTAGGTTGAA
TATGCTATGGCTGCAGTCAACTAGGGTTTATGTTCAATCGGTATTAGAGGTACTGATTGC
ATAGTCATGGGTGTTGAAAAGAACCCAACCACAATTTTGTAAGAAACCAGAACCATTCGT
AAGGTTTAACGTTTGGATGACGCTACTTGCATCTGCTACTCTGGTTTGACTCCTGATGCT
CGTATTCTTACCAACATTGCAAAAGTAGAATGTTAAAGCTATAGTTTGAATTACGATGAT
AGGGTTCCGATCAATTATATTGCAAGATATATTGCTAGTGTTTAGTAAAAGTATACATAA
AAGAGTGGTGCAAGACCATTCGGTATCTCTACCCTTGTAGGTGGTTTCGATAGCAAGGGA
CAACCTCGTTTATTCTAGACAGATCCCAGTGGTGCTTGCACTGAATGGAAGGCTGTCGCA
TTAGGAAAGCACAGAAAGACTGTTATGGAAAACCTTGAAAAGAATTACTAAGAAGAGTAC
TTAGCCGAAGAAAAGTGTCTTGAATTAGCCTGCCGTGTCCTCTTAGAAGTTGTTTAAAGT
GGTTGCAAGAATATTGAATTAGTTGTTCTCAAATAAAAAGTTGAAGGAGATAAGAAAGTT
TATGAATACAGCATGATTTCTGAAGAAAAAACAATGGCTCTTATTGAAGCAGTTGATGGC
AAAAAGTGA