Identifiers and Description

Gene Model Identifier

TTHERM_00158210

Standard Name

PRE5 (20S proteasome core alpha subunit 6)

Aliases

PreTt28411 | 13.m00370 | 3829.m01224

Description

20S proteasome core alpha subunit 6

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • proteolysis involved in cellular protein catabolic process (IEA) | GO:0051603

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00158210

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05277.19.998596099208102e-158proteasome A-type and B-type f
amily protein (256 aa)
DictyBaseDDB_G02823632.000299424410363e-74psmA1 on chromosome: 3 positio
n 5739737 to 5740729
OxytrichaContig1778.0.g61.9999590304423412e-72Proteasome subunit
WormBaseWBGene000039274.99918933170902e-62locus:pas-6 Proteasome subun
it alpha type-1 status:Confi
rmed UniProt:O44156 protei
n_id:CCD65121.1
SGDYMR314W2.9992141389250636e-57PRE5 Alpha 6 subunit of the 20
S proteasome
Stentor CoeruleusSteCoe_209021.8048513878454153e-35

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00158210(coding)
ATGTCATCAAATATCAATTTATACGATACCGATTGTTCCACCTGGTCTACTAACGGAAAG
CTCCTTTAGGTTGATTATGCCACTAAAGCTATTGATCAAGGTTCTATTACAATAGGTTTA
AGATCTCAAAAGTTTGCAGTTTTAGTTGCATAGAAGAGATCTAACAGTAAGTTATCAGGT
TACTAAGAAAAGATTTTCTAAGTTGATGATAAAATTGGTATGGGTGTTGCAGGTATTACT
GCTGATGCAAGAGTCATTTGCAAATATATGAGAACTGAGTGTCTTAACCACAAATATGTA
TATGGAAGCTAACACCCTGCATAGAGATTAGTCATTAAAATTTCTGAAAAATCATAACAT
AAGACTTAAACCTATGGCAAGAGACCTTATGGTGTTGGTACTTTGATTATTGCTTAAGAG
TCAGACGGTCCTAAATTATTCTAGACTTTACCCAGTGGTGACTTCTATGAATTCTATGGT
TAATCTATTGGATCTCGTTCATAAGCTGCTAAAACCTATTTAGAAAATAACTTAGAATTA
TTTAAGGACTGCAATGATCTCAATACCCTTATTTTACATGGTTTGTCTGCTCTTAAGAAA
GCCAACTAAGGTGAAGAAGAATTATTGCCTTAAAGTGTTGATATTGCCTTCGTTGGACTT
GAATCTAACTTCACTCTTTTATCTGAAGATAGAGTTCTCTCATACTTATAACAATTAGAT
ACATTTGCCCCTGCTAATTAGATGGAAGTCGAAAATTGA


>TTHERM_00158210(protein)
MSSNINLYDTDCSTWSTNGKLLQVDYATKAIDQGSITIGLRSQKFAVLVAQKRSNSKLSG
YQEKIFQVDDKIGMGVAGITADARVICKYMRTECLNHKYVYGSQHPAQRLVIKISEKSQH
KTQTYGKRPYGVGTLIIAQESDGPKLFQTLPSGDFYEFYGQSIGSRSQAAKTYLENNLEL
FKDCNDLNTLILHGLSALKKANQGEEELLPQSVDIAFVGLESNFTLLSEDRVLSYLQQLD
TFAPANQMEVEN


>TTHERM_00158210(gene)
AAAAAGCAAACAAAAAATAAAAAATTTATAAATAAAAAACGAAAGGAATAAAAGATTTCT
AAAGTAATAAATAATATTAAATCAAATAAATAGCAAATGTCATCAAATATCAATTTATAC
GATACCGATTGTTCCACCTGGTCTACTAACGGAAAGCTCCTTTAGGTAGTTTTTATAAAA
GCACATTTAATTTTAAGACTATTTTCTAATAGCATGATTGAGCATTTTTGCTTCGTGCAG
TCAACATTCGTTGTTTGTGAGTTTTTGCATTTTCAATATTAATCAAATGCTTAAAAATTT
ACAAACAAGAAGGAACTTTTTTGAATATTTAATGAAAAAAAATTGATAAAATTATTGTTA
AATAAAGGTTGATTATGCCACTAAAGCTATTGATCAAGGTTCTATTACAATAGGTTTAAG
ATCTCAAAAGTTTGCAGTAATTTTCAATCATAATAAATAACTTATTAGCTAGTGGATATT
TTACTGATTAATCTATACAAAAGGTTTTAGTTGCATAGAAGAGATCTAACAGTAAGTTAT
CAGGTTACTAAGAAAAGATTTTCTAAGTTGATGATAAAATTGGTATGGGTGTTGCAGGTA
TTACTGCTGATGCAAGTAAACTTCAAAATATATTTAATATCAAGAGGTAGGTTTAAATTA
AATTGAAATTGTAATAATAATAATAGGAGTCATTTGCAAATATATGAGAACTGAGTGTCT
TAACCACAAATATGTATATGGAAGCTAACACCCTGCATAGAGATTAGTCATTAAAATTTC
TGAAAGTAAATAAATAAATAAATACCTTTTTAATGTTTGGGATTTTATTGATTAAGAAAG
TAGTCTATCTGCATAGCTAATTAACAGCATACAATAAATATAAAAATCTAAGCAAATAAT
TAAGCAATTAATTATACATAGCAAGCATAATTTACTTGTTAAAATTTAAAAAAATAACAA
ATGATAAATATTAAATGAAAGTAGAAGAAGATATTTTAAATAAAATTATAAGCTGCATAA
ATTTAATCAATTAATCTTAGACTATTTTTATTATTAAATTGCTAATAAAATTTTATATTA
ATTTAAAGAATCATAACATAAGACTTAAACCTATGGCAAGAGACCTTATGGTGTTGGTAC
TTTGATTATTGCTTAAGAGGTAAATATTAAATATAAAATTTAGATATTTCAATTTAAATA
AATTATTTATTAATAGTCAGACGGTCCTAAATTATTCTAGACTTTACCCAGTGGTGACTT
CTATGAATTCTATGTAAGAATAATTTGATAATGATAAGCATCATAATTAATAAATTATAA
TTATTTAGGGTTAATCTATTGGATCTCGTTCATAAGCTGCTAAAACCTATTTAGAAAATA
ACTTAGAATTATTTAAGGACTGCAATGATCTCAATACCCTTATTTTACATGGTTTGTCTG
CTCTTAAGAAAGCCAACTAAGGTGAAGAAGAGTAAATTATATTTATATTAAAAAAGATCA
TGAAAGAGAAGTTTCTAAAATAATTTTTATTTAATTAGATTATTGCCTTAAAGTGTTGAT
ATTGCCTTCGTTGGACTTGAATCTAACTTCACTCTTTTATCTGAAGATAGAGTTCTCTCA
TACTTATAACAATTAGATACAGTAATATTTAAAAATTTATTAGTTATAAATAATAAAATA
TTCTAATGTAAAAAATAGTTTGCCCCTGCTAATTAGATGGAAGTCGAAAATTGA