Identifiers and Description

Gene Model Identifier

TTHERM_00548160

Standard Name

PRE4 (20S proteasome core beta subunit 7)

Aliases

PreTt15065 | 71.m00192 | 3729.m00069

Description

20S proteasome core beta subunit 7

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • proteolysis involved in cellular protein catabolic process (IEA) | GO:0051603

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00548160

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17059.17.999597868332553e-175proteasome A-type and B-type f
amily protein (251 aa)
OxytrichaContig22487.0.g859.99860868304602e-64Proteasome subunit
DictyBaseDDB_G02731631.000499495426459e-47psmB4-1 on chromosome: 2 posit
ion 2482779 to 2484020
SGDYFR050C1.9998323414791308e-36PRE4 Beta 7 subunit of the 20S
proteasome
WormBaseWBGene000039531.9996410647472548e-29locus:pbs-7 status:Confirmed
UniProt:P90868 protein_id
:CAB03081.1
Stentor CoeruleusSteCoe_91842.3802664086944007e-26

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00548160(coding)
ATGGCCTTTTACGTTTGCAAAAATAAAGAAAAAATGCATTATAGCGAATTAGCCTTAAAT
GAAAGCTAGGCTAAAAAGCACACCTTGAATCCAATCACTACAGGCTCCAGCGTTATTGGT
ATAGCTTTTAACGGTGGTGTAATTATTGCATCTGATACTTCTATTTCTTATGGTGGTATG
TCAAGATACAATCACATTTAGCGTGTTCATAAAATCACTGACAACTGTGCATTTGCTTCA
AGTGGAGAATTTTCTGATTTTTAGGAACTCTCTCGTTTAATTGATGAAATGACTAATCAA
ACTTACTTAAACGACGATAAGATCAACTACACTCCTCGTGACTATGGTAATTACATCTCT
CAATTATAATATCACCACAGAAATAAGATGAATCCTTTATACCTTTGGAACGTCATCGGA
GGTGTTGATAATGGCAAGCCATATCTTGCTCATATAGATCTTTATGGCACATATATTGAA
ACTAATCACGTTTCAACTGGATTTGGTAACTACCTTTGCGGACCTCTCTTCGAAAAAGGA
TGGAGAGCTGACATGAGTGAATAAGAAGCTAAGTAACTAGTAAACACTTGTTTCTAAGCT
CTCTTCTACAGAGACGCTAGAGCTCATGAAACAATTTAAGTCACAGTTATTGATAAAAAC
GGAGTCCGCATTGAATAACCTTACGAAATCGAATCTAAATGGGACTATTAAGGTTACGTA
AATCGTGCTAACGAAAAAATACACAATTAGTGA


>TTHERM_00548160(protein)
MAFYVCKNKEKMHYSELALNESQAKKHTLNPITTGSSVIGIAFNGGVIIASDTSISYGGM
SRYNHIQRVHKITDNCAFASSGEFSDFQELSRLIDEMTNQTYLNDDKINYTPRDYGNYIS
QLQYHHRNKMNPLYLWNVIGGVDNGKPYLAHIDLYGTYIETNHVSTGFGNYLCGPLFEKG
WRADMSEQEAKQLVNTCFQALFYRDARAHETIQVTVIDKNGVRIEQPYEIESKWDYQGYV
NRANEKIHNQ


>TTHERM_00548160(gene)
ATGGCCTTTTACGTTTGCAAAAATAAAGAAAAAATGCATTATAGCGAATTAGCCTTAAAT
GAAAGCTAGGCTAAAAAGCACACCTTGAATCCAATCACTACAGGCTCCAGCGTTATTGGT
ATAGCTTTTAACGGTGGTGTAATTATTGCATCTGATACTTCTATTTCTTATGGTGGTATG
TCAAGATACAATCACATTTAGCGTGTTCATAAAATCACTGACAACTGTGCATTTGCTTCA
AGTGGAGAATTTTCTGATTTTTAGGAACTCTCTCGTTTAATTGATGAAATGACTAATCAA
ACTTACTTAAACGACGATAAGATCAACTACACTCCTCGTGACTATGGTAATTACATCTCT
CAATTATAATATCACCACAGAAATAAGATGAATCCTTTATACCTTTGGAACGTCATCGGA
GGTGTTGATAATGGCAAGCCATATCTTGCTCATATAGATCTTTATGGCACATATATTGAA
ACTAATCACGTTTCAACTGGATTTGGTAACTACCTTTGCGGACCTCTCTTCGAAAAAGGA
TGGAGAGCTGACATGAGTGAATAAGAAGCTAAGTAACTAGTAAACACTTGTTTCTAAGCT
CTCTTCTACAGAGACGCTAGAGCTCATGAAACAATTTAAGTCACAGTTATTGATAAAAAC
GGAGTCCGCATTGAATAACCTTACGAAATCGAATCTAAATGGGACTATTAAGGTTACGTA
AATCGTGCTAACGAAAAAATACACAATTAGTGA