Identifiers and Description

Gene Model Identifier

TTHERM_00030440

Standard Name

PRE3 (20S proteasome core beta subunit 1)

Aliases

PreTt14275 | 2.m02218 | 3825.m02661

Description

20S proteasome core beta subunit 1

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • proteolysis involved in cellular protein catabolic process (IEA) | GO:0051603

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00030440

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00836.15.002481728998471e-152proteasome A-type and B-type f
amily protein (228 aa)
DictyBaseDDB_G02673902.9997879492220375e-71psmB6 on chromosome: 1 positio
n 487456 to 488497
SGDYJL001W1.0003503620230312e-57PRE3 Beta 1 subunit of the 20S
proteasome, responsible for c
leavage after acidic residues
in peptides
OxytrichaContig18398.0.g121.9997255150861791e-53Proteasome subunit
WormBaseWBGene000039476.000481660141652e-51locus:pbs-1 Proteasome subun
it beta type status:Confirme
d UniProt:Q966I8 protein_i
d:CCD72799.1
Stentor CoeruleusSteCoe_72647.984904245686979e-30

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00030440(coding)
ATGTTCAAAACAGTCCAATCAGATATTTAAATGCTCCCCGATCCTTTTGATTACAAGCAT
GCAGAATCAACAGGAACTTCTATTATGGCTTTAGTTTATGATGGTGGTGTTTTAGTCGGC
GCTGACTCACGTACCACTTCAGGATCTTACATTGCCGATAGAGCTTAAGATAAAGTTGAT
TATTTACATGAACGTATTTACTGTTTAAGAAGTGGTAGCGCAGCTGATACCCAAACTCTT
TGCTCATATGTTCGTTATTATTTAGATGTTCACTCAATGGAATTGCAAAGAAGACCCACT
GTTAAGACTGCTGCCAAGCTCTTCTCAAACTTGATTTATTAATATTAAGATAATTTAAGT
GCTGCAGTTATAGTTGCTGGTATTGATGATAATGAAGGTCCTTCTATCTATGCTTGTTAA
CCCAGTGGCAGTTGCATTAAGTAATAAGTAGCTATCGGTGGTAGTGGTAGTGGTTTTATT
TTCAGTTATGTTGATGCTAACTTTAGACCAAATATGGATCTTGAATCAGCTAAAAAACTT
GTAAAAACTGCCCTTGCTCATGCTATGAGTAGAGATGGTTCTTCAGGTGGTATTATTAGA
CTTGTAAATATCACTAAGGATAATGTTACTCGTGAATTCTTTGATCACAAGGATCTTCCT
TACCACTTCACTAACATACATTGA


>TTHERM_00030440(protein)
MFKTVQSDIQMLPDPFDYKHAESTGTSIMALVYDGGVLVGADSRTTSGSYIADRAQDKVD
YLHERIYCLRSGSAADTQTLCSYVRYYLDVHSMELQRRPTVKTAAKLFSNLIYQYQDNLS
AAVIVAGIDDNEGPSIYACQPSGSCIKQQVAIGGSGSGFIFSYVDANFRPNMDLESAKKL
VKTALAHAMSRDGSSGGIIRLVNITKDNVTREFFDHKDLPYHFTNIH


>TTHERM_00030440(gene)
ATGTTCAAAACAGTCCAATCAGATATTTAAATGCTCCCCGATCCTTTTGATTACAAGCAT
GCAGAATCAACAGGAACTTCTATTATGGCTTTAGTTTATGATGGTGGTGTTTTAGTCGGC
GCTGACTCACGTACCACTTCAGGATCTTACATTGCCGATAGAGCTTAAGATAAAGTTGAT
TATTTACATGAACGTATTTACTGTTTAAGAAGTGGTAGCGCAGCTGATACCCAAACTCTT
TGCTCATATGTTCGTTATTATTTAGATGTTCACTCAATGGAATTGCAAAGAAGACCCACT
GTTAAGACTGCTGCCAAGCTCTTCTCAAACTTGATTTATTAATATTAAGATAATTTAAGT
GCTGCAGTTATAGTTGCTGGTATTGATGATAATGAAGGTCCTTCTATCTATGCTTGTTAA
CCCAGTGGCAGTTGCATTAAGTAATAAGTAGCTATCGGTGGTAGTGGTAGTGGTTTTATT
TTCAGTTATGTTGATGCTAACTTTAGACCAAATATGGATCTTGAATCAGCTAAAAAACTT
GTAAAAACTGCCCTTGCTCATGCTATGAGTAGAGATGGTTCTTCAGGTGGTATTATTAGA
CTTGTAAATATCACTAAGGATAATGTTACTCGTGAATTCTTTGATCACAAGGATCTTCCT
TACCACTTCACTAACATACATTGA