Identifiers and Description

Gene Model Identifier

TTHERM_00379050

Standard Name

PRE2 (20S proteasome core beta subunit 5)

Aliases

PreTt10359 | 40.m00244

Description

20S proteasome core beta subunit 5

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • proteolysis involved in cellular protein catabolic process (IEA) | GO:0051603

Domains

  • ( PF00227 ) peptidase, T1 family
  • ( PF01473 ) Putative cell wall binding repeat

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00379050

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00072.19.997093137033517e-262proteasome (297 aa)
OxytrichaContig14317.0.g832.0006821221283624e-88Proteasome subunit
DictyBaseDDB_G02937849.999030951775615e-88psmB5 on chromosome: 6 positio
n 3275662 to 3276820
SGDYPR103W2.0009803861620222e-78PRE2 Beta 5 subunit of the 20S
proteasome, responsible for t
he chymotryptic activity of th
e proteasome
WormBaseWBGene000039513.999925618735366e-62locus:pbs-5 Proteasome subun
it beta type status:Confirme
d UniProt:Q9XUV0 protein_i
d:CAB04567.1
Stentor CoeruleusSteCoe_185948.194012623990515e-40

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00379050(coding)
ATGGAAAATATCTTATCAACTGAAAACTTAGGTTTCGCTGATTCATTCAACTACACTAGC
AACAAATTGGGTAGATCATTAAATACAAAGTTAGATGATATCGTTAAATCAAATGGTTAA
TTCGGATTTGAATAGGTTCCTTTGAGTGATCCTACTTAACTTGTTCATAATATTAAGGAT
GCCAAGGGTCCTGAGCGTTCTTTGATGGAATTCAAGAAGGGTACAACTACCCTCGCCTTT
AAATTTTAGGGTGGTGTTATCGTTGCAGTCGATTCCAGAGCTTCATAAGGTAGTTTTGAT
GCTTCTGAAACAGTTCGTAAAATCATTGAAATTAACGATCAATTACTCGGAACAATGGCT
GGTGGTGCAGCTGATTGCTAATTCTGGGAGCAATATTTGGCAATTGAATGCAGAAAATAT
CAATTATAAAATCGTGAAAAGGTTTCTGTTGCAGCTGCCTCAAGAATCCTGATTAATATT
TTATATTCCTACAGAAATCATGGACTCTCTATGGGTTGTATGCTTACTGGATGGGATCAC
GAAGGTGCTTAGCTCTACTATCTTGATAACGATGGTCAAAGAATTAAGGGAAACATTTTC
TCTTGTGGTTCTGGTTCTACTTATGCCTATGGTGTTCTAGATAACGAATATCATTACAAT
TTAAGTGTAAAGGAAGCAGCTGAATTAGGTAGAAAGGCAATTTATCATGCCACTCATAGA
GATGCTGGTTCTGGTGGTGTTGTTAGAATTTATCACGTCCATGCTCCTAATGCTTAAGGT
AAGGGCTGGACCATTATTGAAGATGGTGAAGATGTTAATAAACTCCACTACTTCTACGAA
GGTGCTAAAGGAGCTGTTGGTGATGGTGATTTCGTCAATGCTGAACTCTTGTGA


>TTHERM_00379050(protein)
MENILSTENLGFADSFNYTSNKLGRSLNTKLDDIVKSNGQFGFEQVPLSDPTQLVHNIKD
AKGPERSLMEFKKGTTTLAFKFQGGVIVAVDSRASQGSFDASETVRKIIEINDQLLGTMA
GGAADCQFWEQYLAIECRKYQLQNREKVSVAAASRILINILYSYRNHGLSMGCMLTGWDH
EGAQLYYLDNDGQRIKGNIFSCGSGSTYAYGVLDNEYHYNLSVKEAAELGRKAIYHATHR
DAGSGGVVRIYHVHAPNAQGKGWTIIEDGEDVNKLHYFYEGAKGAVGDGDFVNAELL


>TTHERM_00379050(gene)
ATGGAAAATATCTTATCAACTGAAAACTTAGGTTTCGCTGATTCATTCAACTACACTAGC
AACAAATTGGGTAGATCATTAAATACAAAGTTAGATGATATCGTTAAATCAAATGGTTAA
TTCGGATTTGAATAGGTTCCTTTGAGTGATCCTACTTAACTTGTTCATAATATTAAGGAT
GCCAAGGGTCCTGAGCGTTCTTTGATGGAATTCAAGAAGGGTACAACTACCCTCGCCTTT
AAATTTTAGGGTGGTGTTATCGTTGCAGTCGATTCCAGAGCTTCATAAGGTAGTTTTGAT
GCTTCTGAAACAGTTCGTAAAATCATTGAAATTAACGATCAATTACTCGGAACAATGGCT
GGTGGTGCAGCTGATTGCTAATTCTGGGAGCAATATTTGGCAATTGAATGCAGAAAATAT
CAATTATAAAATCGTGAAAAGGTTTCTGTTGCAGCTGCCTCAAGAATCCTGATTAATATT
TTATATTCCTACAGAAATCATGGACTCTCTATGGGTTGTATGCTTACTGGATGGGATCAC
GAAGGTGCTTAGCTCTACTATCTTGATAACGATGGTCAAAGAATTAAGGGAAACATTTTC
TCTTGTGGTTCTGGTTCTACTTATGCCTATGGTGTTCTAGATAACGAATATCATTACAAT
TTAAGTGTAAAGGAAGCAGCTGAATTAGGTATTAATTTCGATTATTATTATTATCAAAAC
AAAAATCATTAGCACTTAAATTCATTAGCAAGTTAAATAAATAAACAGCTAAGCACCTTA
ATATATCAGTATAGTTGTGTGATCCATAAAATGATAAATCCTTTATGATCTCAAAAATTT
CAAATCAATTAATGATCAAATTGCTTATTAATTTATGCATTTAAAAAAATTTGATTTAGT
TTTAGTATTTTTATTGATAAGCAATAAGATTGATTGATTGATTTCAATAAACTAAACTGA
CTGAAAAACTTGCAAATAAATGATTTAAATGAATTTAAATAAAAATAATTTAAACTTATT
TTTTTAATAAAACAGGTAGAAAGGCAATTTATCATGCCACTCATAGAGATGCTGGTTCTG
GTGGTGTTGTTAGAAGTATCGATATCTTTTACCATTCAACTTAGCATTTATTCATTAATT
TTTTCCCTAACAAATAATAGTTTATCACGTCCATGCTCCTAATGCTTAAGGTAAGGGCTG
GACCATTATTGAAGATGGTGAAGATGTTAATAAACTCCACTACTTCTACGAAGGTGCTAA
AGGTAAATTGATAATTTAAATATAATTTTAACCTTTGTTAATATAATTTTAATTAAAAAT
GTTTAGGAGCTGTTGGTGATGGTGATTTCGTCAATGCTGAACTCTTGTGA