Identifiers and Description

Gene Model Identifier

TTHERM_00487110

Standard Name

PRE10 (20S proteasome core alpha subunit 7)

Aliases

PreTt19642 | 59.m00280 | 3680.m00137

Description

20S proteasome core alpha subunit 7

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • proteolysis involved in cellular protein catabolic process (IEA) | GO:0051603

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.6%

TetraMine Data

TTHERM_00487110

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12217.11.0004236668521093e-146proteasome A-type and B-type f
amily protein (244 aa)
OxytrichaContig21046.0.g149.996907204735647e-62Proteasome subunit
DictyBaseDDB_G02674081.999576471039937e-58psmA3 on chromosome: 1 positio
n 277655 to 278789
SGDYOR362C4.9986056260133516e-43PRE10 Alpha 7 subunit of the 2
0S proteasome
WormBaseWBGene000039285.001052752541194e-37locus:pas-7 Proteasome subun
it alpha type-3 status:Confi
rmed UniProt:Q09583 protei
n_id:CAA88436.2
Stentor CoeruleusSteCoe_77103.532628572200807e-24

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00487110(coding)
ATGAACGATTTATCAGTCACAACTTTCACTCAAGACGGCTATATTAAGTAAGTAGAGTAT
GCACAAAAAGCAGTCAGCGATAGCGAAACTATTTTAGGTGTAAGATGTAAGGATGGTGTT
ATTTTAGGTGCTGAAAAGAAATTATAAACTAAACTTATGGTTGAAGACTCTGACAGAAGA
ATTTATAATATTTAAAAAAATATCGGAATGATTGTTGGTGGTAGAATTCCAGATGGTAGA
AATGTAGTCCATAGAGCTAGAAAAGAAGCTTAGGAATACGAAAAATATTTTTCTATGCCA
ATTTCAGGAAGAATTTTGTCTGAAAGAACAGGATAATATCTTCATGCTCACACTTTATAC
GGAGCCTACAGACCTTTTGGTTGCTCTGTTATTATTTCATCATATGATCCTATTGATGGT
CTTCAATTACATCAATCTGATAACGCTGGTTACTGCTTAGGTTATTATGCTTGTGCTTAA
GGATAAGGTAAACAAGAAGTTATGGCCCATTTCGGTAGAAGAAATTTTAGAGATTTAACT
TGTGAAGAAGCCCTTCCCTATGTTATATTAGCTTTAAATAAGGCACGTAAAGAAGCCAAT
GAAGGTATTTATCAATATGAAGTAAGTTGGATCACTGAAAAGAATAACTATGTTCATTGC
CATGTTCCAAACGATATTAGAGACTCTGCCCAAGTTCAAGCTGAAGCTATGATTGAAGCT
GAAGATTCTGCTTGA


>TTHERM_00487110(protein)
MNDLSVTTFTQDGYIKQVEYAQKAVSDSETILGVRCKDGVILGAEKKLQTKLMVEDSDRR
IYNIQKNIGMIVGGRIPDGRNVVHRARKEAQEYEKYFSMPISGRILSERTGQYLHAHTLY
GAYRPFGCSVIISSYDPIDGLQLHQSDNAGYCLGYYACAQGQGKQEVMAHFGRRNFRDLT
CEEALPYVILALNKARKEANEGIYQYEVSWITEKNNYVHCHVPNDIRDSAQVQAEAMIEA
EDSA


>TTHERM_00487110(gene)
ATGGTAAAATAAATTAATTACTTACCTACTCAGATTATCTAAATGTCTCCTTATTATTTG
ATTCAATACTTATATTATATTTCCTTAATGCCACACATTAGAAATATAATTTGGTTTGAT
GATAGGAGACATACATAAATAACGAAATTAAATAGTTAATATGTATATATTTTAAAAATA
AACCAAATAAAACTTAGAACGATTTATCAGTCACAACTTTCACTCAAGACGGCTATATTA
AGTAAGTAGAGTATGCACAAAAAGCAGTCAGCGATAGCGAGTAATTAAATTTTTTATCAT
TATTAAAATAAAAATAGTTATTTTTGATAGCAATTATTATATCAATTGAGCATTCTAAAT
CAATAAATAATTTGATGAAAATATTTTTTAAAACATTTTATTTCTTTAAAATCTAATGAT
TTCATTTAAAAAGAACTATTTTAGGTGTAAGATGTAAGGATGGTGTTATTTTAGGTGCTG
AAAAGAAATTATAAACTAAACTTATGGTTGAAGACTCTGACAGAAGAATTTATAATATTT
AAAAAAATATCGGAATGGTAATTATTTAGATTACTACTCAATATTCAAATAAAGCAAAAC
TGTTTTTGTTTTTATTCAATCATTTAATCAACTTATTTTAGATAAAATTTGTTGATGAAA
TTGATCTGATTATCAACTTAGAAATTCCATACTTTGGATTATCTTTTTATTTACTTTTTA
TATTTTAAATAATATAAGATTGTTGGTGGTAGAATTCCAGATGGTAGAAATGTAGTCCAT
AGAGCTAGAAAAGAAGCTTAGGAATACGAAAAATATTTTTCTATGCCAATTTCAGGAAGA
GTAAATAACTTTTTAAATTGAAATTAAAGCTTGAAAAGCTTTGTTTAAATAGCTTATTAT
AATATATCGAAAGCTTTTTCATATAAATATAAATTCTAATAATAATTTCTTATGAAAACA
GATTTTGTCTGAAAGAACAGGATAATATCTTCATGCTCACACTTTATACGGAGCCTACAG
ACCTTTTGGTTGCTCTGTTATTATTTCATCATATGATCCTATTGATGGTCTTCAATTACA
TCAATCTGATAACGCTGGTTACTGCTTAGTAAAAAAAAAATAATATTTTTTATAAATCTA
GAGTTATTTATCTATTAAAATAAAACAAAGGGTTATTATGCTTGTGCTTAAGGATAAGGT
AAACAAGAAGTTATGGCCCATTTCGGTAGAAGAAATTTTAGAGATTTAACTTGTGAAGAA
GCCCTTCCCTATGTTATATTAGCGTAAAATAAATAATAAATATTTAAAAAGAAAAGAGTA
ATTATAAAAATTAAATATTATAAAATTAGTTTAAATAAGGCACGTAAAGAAGCCAATGAA
GGTATTTATCAATATGAAGTAAGTTGGATCACTGAAAAGAATAACTATGTTCATTGCCAT
GTTCCAAACGATATTAGAGTAATAATCTACAATTTTTTCAGATTAAAAAAAAACTCTAAT
TCATATATTTAGGATAATAAAAATAAAAATCATATGTTAATTAAATATTTATTTAAAAAT
AGGACTCTGCCCAAGTTCAAGCTGAAGCTATGATTGAAGCTGAAGATTCTGCTTGA