Identifiers and Description

Gene Model Identifier

TTHERM_00147560

Standard Name

PRE1 (20S proteasome core beta subunit 4)

Aliases

PreTt20614 | 12.m00560 | 3700.m00011

Description

20S proteasome core beta subunit 4

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • proteolysis involved in cellular protein catabolic process (IEA) | GO:0051603

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 15%

TetraMine Data

TTHERM_00147560

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04911.18.998537725811687e-130proteasome A-type and B-type f
amily protein (192 aa)
OxytrichaContig20509.0.g608.00275873087502e-68Proteasome subunit
DictyBaseDDB_G02694722.99915080840225e-45psmB2 on chromosome: 1 positio
n 2839118 to 2839714
SGDYER012W4.9986056260133516e-43PRE1 Beta 4 subunit of the 20S
proteasome; localizes to the
nucleus throughout the cell cy
cle
Stentor CoeruleusSteCoe_65433.221340285992516e-27
WormBaseWBGene000039502.9990241513684e-21locus:pbs-4 Proteasome subun
it beta type-2 status:Confir
med UniProt:P91477 protein
_id:CCD67779.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00147560(coding)
ATGGACTCAGCTTTTGGTTTAGTAGGAAAAGATTTCGTAATTGTTGCCACTGACTGTTCA
GTTGCTTATTCCATCCTTAAGTTGAAGGATAAGGAAGATAAAATCTCATTGTTAGATTAA
AATAAAGTTATGGCTTTGAGCGGTGAACAAGCCTATCGTTTGTAATTCTCTGATTATATT
GCTAAAAATATTGCTTTAAATAAATATCGTAACGGTACAGAATTTAACACCAAGGAATGT
GCTGAGTTTGTTAGATCTGAACTAGCTTATGGTATCAGAAATGGTCCCTTCATGGTTAAT
TGTCTTATTGCAGGTTTTGATAATAATTAACCTTAATTATATTGGGTTGACTATATGGGA
ACTCTCGTTAAAAGTGTTAAAGCTGCTCATGGATATGCTGCTCACTTTGTTTTGAGTACA
CTCGATCATGACTACAAGCCCAATTTGACTTTAGATGAAGGAATAGCTATTATAAAGCGT
TGCATCAATGAATTAAAAACAAGATTCTTGATTTCACAAAGCCATTTTATTGCTAAGATA
GTCACTCCCGCTGGTATTTAAGTTCTTGAATTGTGA


>TTHERM_00147560(protein)
MDSAFGLVGKDFVIVATDCSVAYSILKLKDKEDKISLLDQNKVMALSGEQAYRLQFSDYI
AKNIALNKYRNGTEFNTKECAEFVRSELAYGIRNGPFMVNCLIAGFDNNQPQLYWVDYMG
TLVKSVKAAHGYAAHFVLSTLDHDYKPNLTLDEGIAIIKRCINELKTRFLISQSHFIAKI
VTPAGIQVLEL


>TTHERM_00147560(gene)
ATGGACTCAGCTTTTGGTTTAGTAGGAAAAGATTTCGTAATTGTTGCCACTGACTGTTCA
GTTGCTTATTCCATCCTTAAGTTGAAGGTAATTATCCTTCTTTAATTCAATACCCTAGTC
ATTTTGCTAATGTAGTTTCAAAATCATCACATATGAGCAGTATCTCAAGAGATTGTGCAG
CAAAAGCTAATGCACACAAAACATAATCAATTATAATCTAAAATACATAAGATAATACAA
ATCAGAAACATAAAGGCATTTAAAAAATGAAATTTATGCAGCTATAAGTTTAGTTAAAAG
AAGCACAATATGCTTTATCACAAATAAATTTTAGCAAATAATTTAAAAATTTATATAAAT
ACTTGTTAATAAATATTAGGATAAGGAAGATAAAATCTCATTGTTAGATTAAAATAAAGT
TATGGCTTTGAGCGGTGAACAAGCCTATCGTTTGTAATTCTCTGATTATATTGCTAAAAA
TATTGCTTTAAATAAATATCGTAACGGTACAGAATTTAACACCAAGGAATGTGCTGAGTT
TGTTAGGTATTTAGTTGTTAAATTATTAAAAAATTTTATTGAGATAAGCTTAGTTTATTA
GTTATTTGTGCCTCTCTCTTAACATAAAATATTTATAATTATAAATATAATTTAGATCTG
AACTAGCTTATGGTATCAGAAATGGTCCCTTCATGGTTAATTGTCTTATTGCAGGTTTTG
ATAATAATTAACCTTAATTATATTGGGTTGACTATATGGGAACTCTCGTTAAAAGTGTTA
AAGCTGCTCATGGGTAAATTCATAAATAATGCTACTATTAAAAATTTAAATCTCTTTTTA
AATATTTAGATATGCTGCTCACTTTGTTTTGAGTACACTCGATCATGACTACAAGCCCGT
AAAAAATATTAATTAAAAATATCTGAAATAAAGTTTATTAATTTCCGTTTTTATAAATAA
TTAGAATTTGACTTTAGATGAAGGAATAGCTATTATAAAGCGTTGCATCAATGAATTAAA
AACAAGATTCTTGATTTCACAAAGCCATTTTATTGCTAAGATAGTCACTCCCGTAATAAA
AACATTTAATCTATATTATATAACTTACTCATATTTTCTCATTTTTAATAAAGGCTGGTA
TTTAAGTTCTTGAATTGTGA