Identifiers and Description

Gene Model Identifier

TTHERM_00865290

Standard Name

PPO1 (protein phosphatase 1 (PP1) ortholog)

Aliases

PreTt29159 | 154.m00117 | 3751.m00463

Description

Glc7-like protein phosphatase. !!! Note that TTHERM_00865290 and TTHERM_00865300 are parts of a single gene !!!

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00865290

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_91870
Tetrahymena borealisEI9_19695.19.997093137033517e-262serine/threonine protein phosp
hatase PP1 (315 aa)
WormBaseWBGene000017481.9991691033935208e-179locus:gsp-2 Serine/threonine
-protein phosphatase PP1-beta
status:Confirmed UniProt:P
48727 protein_id:CCD61828.1
DictyBaseDDB_G02756199.001500394647905e-175pppB on chromosome: 2 position
6106886 to 6107851
SGDYER133W9.998061997456677e-175GLC7 Type 1 serine/threonine p
rotein phosphatase catalytic s
ubunit, involved in many proce
sses (eg: glycogen metabolism,
sporulation, mitosis); accumu
lates at mating projections by
interaction with Afr1p; inter
acts with many regulatory subu
nits
OxytrichaContig11781.0.0.g153.0005817332825333e-174Calcineurin-like phosphoestera
se

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:22426537: Song X, Bowen J, Miao W, Liu Y, Gorovsky MA (2012) The nonhistone, N-terminal tail of an essential, chimeric H2A variant regulates mitotic H3-S10 dephosphorylation. Genes & development 26(6):615-29
  2. Ref:10199406: Wei Y, Yu L, Bowen J, Gorovsky MA, Allis CD (1999) Phosphorylation of histone H3 is required for proper chromosome condensation and segregation. Cell 97(1):99-109
  3. Ref:9636175: Wei Y, Mizzen CA, Cook RG, Gorovsky MA, Allis CD (1998) Phosphorylation of histone H3 at serine 10 is correlated with chromosome condensation during mitosis and meiosis in Tetrahymena. Proceedings of the National Academy of Sciences of the United States of America 95(13):7480-4

Sequences

>TTHERM_00865290(coding)
ATGGACGGAAAAACAGTCATTGATATTGATGATATCCTATCAAAATTGATAGATCCAAAG
CAAAGTAGAGCAGCTAAAAGTTAGGTTTTGGCTGAAAGCGAAATTAGGGCTGTTTGCATG
AAGTCAAGAGAAATCTTTTTGCAATAGCCAATGCTTTTAGAGTTAGAAGCTCCCATTAAA
ATTTGTGGTGATGTTCATGGCCAATTCCCTGATTTACTTAGAATTTTCGAATACGGAGGA
TTCCCTCCTGATGCCAATTATCTCTTTTTAGGAGATTACGTTGATAGAGGCAAATAATCA
CTAGAAACAATTTGTTTGCTCTTAGCTTATAAAATCAAATTTCCTGAGAATTTCTTCTTG
CTTCGTGGTAACCACGAATGCTCCTCCATTAATCGTATATATGGTTTCTATGATGAATGT
AAAAGAAGATATAATATAAAGCTCTGGAAAATTTTTACTGACTGCTTTAATTGCCTTCCA
GTCTGTGCAGTGATAGATGAAAAAATTATTTGTATGCACGGAGGTCTTTCACCTTCTCCT
GAATTTAATAATATAGAATCTATTCATCGTATAACACGTCCAATTGAAGTTCCTGACTAA
GGTTTATTATGCGATCTATTGTGGAGTGACCCTGAAAAAGATATTCTTGGTTGGGGTGAT
AATGAAAGAGGTGTTAGTTATATATTTGGACCAGATGAGGTCTCGAAATTCCTAAAGAAA
TAAGATTTAGATTTAATATGTAGAGCACATTAGGTAGTCGAAGATGGATATGAGTTCTTC
GCAAAAAGATAGTTAGTCACAATCTTTTCAGCTCCTAATTATTGTGGTGAATTTGATAAT
TGCGGTGCTTTAATGTCTGTAGATGAGACTTTAATGTGTAGCTTCTAAATATTAAAACCT
GCAGATAAAAAATCTTAAACTTAACGTCCTAAAACTCCAAAGTTTGTCAATTGA


>TTHERM_00865290(protein)
MDGKTVIDIDDILSKLIDPKQSRAAKSQVLAESEIRAVCMKSREIFLQQPMLLELEAPIK
ICGDVHGQFPDLLRIFEYGGFPPDANYLFLGDYVDRGKQSLETICLLLAYKIKFPENFFL
LRGNHECSSINRIYGFYDECKRRYNIKLWKIFTDCFNCLPVCAVIDEKIICMHGGLSPSP
EFNNIESIHRITRPIEVPDQGLLCDLLWSDPEKDILGWGDNERGVSYIFGPDEVSKFLKK
QDLDLICRAHQVVEDGYEFFAKRQLVTIFSAPNYCGEFDNCGALMSVDETLMCSFQILKP
ADKKSQTQRPKTPKFVN


>TTHERM_00865290(gene)
ATGGACGGAAAAACAGTCATTGATATTGATGATATCCTATCAAAATTGATAGATCCAAAG
CAAAGTAGAGCAGCTAAAAGTTAGGTTTTGGCTGAAAGCGAAATTAGGGCTGTTTGCATG
AAGTCAAGAGAAATCTTTTTGCAATAGCCAATGCTTTTAGAGTTAGAAGCTCCCATTAAA
ATTTGTGGTAATTAGAAGCCTTATTTTTCGATAAAATTAAAATAAATGTTTTTAGGGTAA
CATTAAGGCAATAAAAAACATTTAAATAATAGGTGATGTTCATGGCCAATTCCCTGATTT
ACTTAGAATTTTCGAATACGGAGGATTCCCTCCTGATGCCAATTATCTCTTTTTAGGAGA
TTACGTTGATAGAGGCAAATAATCACTAGAAACAATTTGTTTGCTCTTAGCTTATAAAAT
CAAATTTCCTGAGAATTTCTTCTTGCTTCGTGGTAACCACGAATGCTCCTCCATTAATCG
TATATATGGTTTCTATGATGAATGTAAGAGTTTTTATTTTTAAGGAGAAATTAATTTCTG
CTCAGAGCAGCCTAAATTCGTGTTTTCAAAAATTAGAAGAAAATGATTGAAAGTTTTTTA
AATAAGAAGGATAAATAACAGAAAAAATAATAGATTATTTCTAGCTAATCACACTATTTT
CAATTAAAAAAAGCAATTATATTTGAAATATTTCTCATTAAGTCAAATAAATTTGCTCAT
TTTTAGCTAATAACTTATTTTGTAATTTAATTGTATATGAAATAAAAAGGTAAAAGAAGA
TATAATATAAAGCTCTGGAAAATTTTTACTGACTGCTTTAATTGCCTTCCAGTCTGTGCA
GTGATAGATGAAAAAATTATTTGTATGCACGGAGGTCTTTCACCTTCTCCTGAATTTAAT
AATATAGAATCTATTCATCGTATAACACGTCCAATTGAAGTTCCTGACTAAGGTTACTAA
TTAACTAACTATCTTACCAAACAAACATCAAAATTTATTTTCTCTACTTTCAAAATTAAC
TGATAGAATTTTTAAAAAATGAATATTTCAAGATCTTTCTAGTTAGCAAAACAAGGAAAT
AGCACATGTTTATTCTTTCATACATACTAAATTGATGTTAATTATTTTTTTAGTGCAAAC
ACTATCTTAAAGAAAGATTAATTGTCACTTAAGATTCATAAATTTAGCGAAGCAAAAAAT
ATGAAGCAAAATAAAGTATTGAATAAATCAGATTCAAGTGAAATAGATTATTCAACTTAT
TTTTATCACAAACTTTAACCAGAATATTATCTAACTAAATGTTACTTCCAATAGAATAAT
TCATACTTAAAAATTTAGTGATGTTCAATAATATTTGTATTATCAATAAAAAATAATAAT
GGATAACTAAACTAAAGGAAATTAAATCATATTTAAGATTTACAAATATATAAAAATAAG
TAAGCATATATATAATAATAAAGTAGCTTCAACCAACATCTAACAAAAAAGTTAAAATTT
AGAGAAAATAAATATATTTTAATCACTTTAAGTTTGACTAAAAATAATAATTATTAAAAT
TTAAAATAGGTTTATTATGCGATCTATTGTGGAGTGACCCTGAAAAAGATATTCTTGGTT
GGGGTGATAATGAAAGAGGTGTTAGTTATATATTTGGACCAGATGAGGTCTCGAAATTCC
TAAAGAAATAAGATTTAGATTTAATATGTAGAGCACATTAGGTAGTCGAAGATGGATATG
AGTTCTTCGCAAAAAGATAGTTAGTCACAATCTTTTCAGCTCCTAATTATTGTGGTGAAT
TTGATAATTGCGGTAAATTATTTTTTAATAAGCAAATAATGGTATTAAAATTTGACATTT
TATCTATAATTTTATTATTATTTAATTAGGTGCTTTAATGTCTGTAGATGAGACTTTAAT
GTGTAGCTTCTAAATATTAAAACCTGCAGATAAAAAATCTTAAACTTAACGTCCTAAAAC
TCCAAAGGTAATTATTTAGAAGTATTTTAAGTATAAGTTAATGCAAAATTTATTTTATAA
AAAAAGTTTGTCAATTGA