Identifiers and Description

Gene Model Identifier

TTHERM_01345810

Standard Name

PPN1 (eNdoPolyPhosphatase)

Aliases

PreTt01650 | 337.m00015 | 3805.m00069

Description

Putative endopolyphosphatase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01345810

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_21114.19.997093137033517e-262Ser/Thr protein phosphatase (3
40 aa)
OxytrichaContig5227.0.g535.001363273675253e-167Calcineurin-like phosphoestera
se
WormBaseWBGene000023631.9999565133760522e-166locus:let-92 Serine/threonin
e-protein phosphatase status
:Confirmed UniProt:G5EGK8
protein_id:CAB01174.1
DictyBaseDDB_G02902632.0001055857497602e-161pho2a on chromosome: 5 positio
n 3933600 to 3934867
SGDYDL188C1.0001043265246556e-154PPH22 Catalytic subunit of pro
tein phosphatase 2A (PP2A), fu
nctionally redundant with Pph2
1p; methylated at C terminus;
forms alternate complexes with
several regulatory subunits;
involved in signal transductio
n and regulation of mitosis
Stentor CoeruleusSteCoe_8281.4788975056432133e-74

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:17821280: Harrison JA, Fowler EH (1945) AN ANTIGEN-ANTIBODY REACTION WITH TETRAHYMENA WHICH RESULTS IN DYSTOMY. Science (New York, N.Y.) 102(2638):65-6

Sequences

>TTHERM_01345810(coding)
ATGCCTCCCAAACTAACTAGTAGCGATCTTGGTAATTTTGATAAGTACATTGAGCAGCTT
TGGTAATGCAAGCCATTAGCTGAAAACGATGTAAAAATATTGTGTGATAAGGTCAAAGAA
ATTTTAGCTGAAGAAAATAATGTAACTACAGTAAAAGCACCTGTGACCGTTTGCGGTGAT
ATCCATGGCTAATTCCATGATTTGATTGAACTGTTCAGAATAGGCGGTAAACCTCCTGAT
ACTAACTATCTTTTCATGGGTGATTATGTAGATAGAGGTTCAAATTCAGTAGAAACAGTA
TCCTTAATATTCTCATTAAAAGTACGCTTTAAAGATCGTGTAACTATTTTGAGAGGTAAT
CACGAAAACAGAGAAATCAATAAGATTTATGGTTTTTATGATGAATGCTACAAAAAGTAC
GGCAACGAAAATGTTTGGAAATACTTTACTGACGTTTTCCTCTATCTCCCTCTTACTGCC
TTAATTGAATCTCAGCTTTTCTGTTTACATGGTGGTTTGTCTCCAGCTATTGAAAATCTT
GACCAAATTCGTTCTCTTAATCGTTTCTAAGAACTCCCTCACGAAGGTCCTATGTGTGAC
CTTTTATGGTCAGATCCTGATGATTAAAGAACTGGTTGGGGTCTTTCTCCTAGAGGTGCA
GGATGGACTTGGGGTCATGATATCACTGAAAAATTCATTCACTAAAATAAATTAAAGCTC
ATTGCCAGAGCTCACTAACTTGTTATGGATGGATATCAGCATGTTCATAATAAAAAGTGT
GTAACTATTTTCTCAGCACCAAATTATTGTTATAGATGTGGTAATTAGGCTTCAATTATG
GAAGTTGACGATGGTCTTAAGCTAAACTATATGTAATTCGAACCTGCTCCTAGAACAAAC
GAACCTCATGCTTCTCGTAGAGTTCCTGACTATTTCCTTTGA


>TTHERM_01345810(protein)
MPPKLTSSDLGNFDKYIEQLWQCKPLAENDVKILCDKVKEILAEENNVTTVKAPVTVCGD
IHGQFHDLIELFRIGGKPPDTNYLFMGDYVDRGSNSVETVSLIFSLKVRFKDRVTILRGN
HENREINKIYGFYDECYKKYGNENVWKYFTDVFLYLPLTALIESQLFCLHGGLSPAIENL
DQIRSLNRFQELPHEGPMCDLLWSDPDDQRTGWGLSPRGAGWTWGHDITEKFIHQNKLKL
IARAHQLVMDGYQHVHNKKCVTIFSAPNYCYRCGNQASIMEVDDGLKLNYMQFEPAPRTN
EPHASRRVPDYFL


>TTHERM_01345810(gene)
ATGCCTCCCAAACTAACTAGTAGCGATCTTGGTAATTTTGATAAGTACATTGAGCAGCTT
TGGTAATGCAAGCCATTAGCTGAAAACGATGTAAAAATATTGTGTGATAAGGTAATTATT
TTAAAGATGCTAGTCTGTATATTTAGATATTTAATCGATTTATATAGGTCAAAGAAATTT
TAGCTGAAGAAAATAATGTAACTACAGTAAAAGCACCTGTGACCGTTTGCGGTGATATCC
ATGGCTAATTCCATGATTTGATTGAACTGTTCAGAATAGGCGGTAAACCTCCTGTAAGAT
TTTTGTTTTGGTTCTATTTAAAGTTGAGGAATAAAAGCCATAAAATTTTATTTAAATAAG
GCCTTCTCTAAAAGTACGTTTTTTTTGATAGTCAGTCTTCACTTTCTTTATATTAAAGAG
AAAGAAAAAAGAAATTAAAGATTAGTTGCTTTTTTAAATATATTTAGAAGTGAAATAAAA
ATTTTAGAAAGTCCAATAATAAATTAATAAATTATATTAATTACTTGCTTCGCAAACCAA
ATAATTATTAAACTAATTATTTGTTTGTTTGTTCATTAATTCATCAAACTATTTAGAGAT
TTATTTTTACTTTTTATTTAAATTCACTAAACTAAAAAATAAATGACTGACTGACAGAAT
AACTTTTTTTAGTACTTAATTCCTTAAAACAATTTATTCCATTCGTTAGTTAATTTTTAT
TTGTTTATATTTTAGGATACTAACTATCTTTTCATGGGTGATTATGTAGATAGAGGTTCA
AATTCAGTAGAAACAGTATCCTTAATATTCTCATTAAAAGTACGCTTTAAAGATCGTGTA
ACTATTTTGAGAGGTAATCACGAAAACAGAGAAATCAATAAGATTTATGGTTTTTATGAT
GAATGCTACAAAAAGTACGGCAACGAAAATGTTTGGAAATACTTTACTGACGTTTTCCTC
TATCTCCCTCTTACTGCCTTAATTGAATCTCAGGTACTTATTTGCTTAATTACATATTTT
AATCTAATCATTCAATCATTAGTTAATTTGTTTATGCAATCACATCAAAAATGTTTTAAG
TAAATCCTATTTAAGATGGATTTTCAAGAATGATATTATGATTTGAAAATAACTAACAAA
TTTTAAGTAAAAAAATTAATATTGAAATTTTAAAAATTTAGCTTTTCTGTTTACATGGTG
GTTTGTCTCCAGCTATTGAAAATCTTGACCAAATTCGTTCTCTTAATCGTTTCTAAGAAC
TCCCTCACGAAGGTCCTATGTGTGACCTTTTATGGTCAGATCCTGATGATTAAAGAACTG
GTAATTCAAAATTAACTTACTTTTATTATAAAACTTATGTTAAAACTAATTTGATAAATT
CATATAGGTTGGGGTCTTTCTCCTAGAGGTGCAGGATGGACTTGGGGTCATGATATCACT
GAAAAATTCATTCACTAAAATAAATTAAAGCTCATTGCCAGAGCTCACTAACTTGTTATG
GATGTAATAAAATTGATAATTAATTTATAGGAACAAGCAAGATTTGAAAGAAATAAATGT
ATAATTAATATTATATAAATAAATAGGGATATCAGCATGTTCATAATAAAAAGTGTGTAA
CTATTTTCTCAGCACCAAATTATTGTTATAGATGTGGTAATTAGGCTTCAATTATGGAAG
TTGACGATGGTCTTAAGCTAAACTAGTAAATAAAATTCTAAAATTAAATTAAACAGAATT
TCTAAAAGTTTTTCAATCCAAATAATAATTAATTAATCCTTTTCTATTTACTTAAAAAAT
TAGTATGTAATTCGAACCTGCTCCTAGAACAAACGAACCTCATGCTTCTCGTAGAGTTCC
TGACTATTTCCTTTGA