Identifiers and Description

Gene Model Identifier

TTHERM_01345810

Standard Name

PPN1 (eNdoPolyPhosphatase)

Aliases

PreTt01650 | 337.m00015 | 3805.m00069

Description

PPN1 serine/threonine protein phosphatase 2A; Putative endopolyphosphatase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_01345810

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_21114.19.997093137033517e-262Ser/Thr protein phosphatase (3
40 aa)
OxytrichaContig5227.0.g535.001363273675253e-167Calcineurin-like phosphoestera
se
WormBaseWBGene000023631.9999565133760522e-166locus:let-92 Serine/threonin
e-protein phosphatase status
:Confirmed UniProt:G5EGK8
protein_id:CAB01174.1
DictyBaseDDB_G02902632.0001055857497602e-161pho2a on chromosome: 5 positio
n 3933600 to 3934867
SGDYDL188C1.0001043265246556e-154PPH22 Catalytic subunit of pro
tein phosphatase 2A (PP2A), fu
nctionally redundant with Pph2
1p; methylated at C terminus;
forms alternate complexes with
several regulatory subunits;
involved in signal transductio
n and regulation of mitosis
Stentor CoeruleusSteCoe_8281.4788975056432133e-74

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:17821280: Harrison JA, Fowler EH (1945) AN ANTIGEN-ANTIBODY REACTION WITH TETRAHYMENA WHICH RESULTS IN DYSTOMY. Science (New York, N.Y.) 102(2638):65-6

Sequences

>TTHERM_01345810(coding)
ATGCCTCCCAAACTAACTAGTAGCGATCTTGGTAATTTTGATAAGTACATTGAGCAGCTT
TGGTAATGCAAGCCATTAGCTGAAAACGATGTAAAAATATTGTGTGATAAGGTCAAAGAA
ATTTTAGCTGAAGAAAATAATGTAACTACAGTAAAAGCACCTGTGACCGTTTGCGGTGAT
ATCCATGGCTAATTCCATGATTTGATTGAACTGTTCAGAATAGGCGGTAAACCTCCTGAT
ACTAACTATCTTTTCATGGGTGATTATGTAGATAGAGGTTCAAATTCAGTAGAAACAGTA
TCCTTAATATTCTCATTAAAAGTACGCTTTAAAGATCGTGTAACTATTTTGAGAGGTAAT
CACGAAAACAGAGAAATCAATAAGATTTATGGTTTTTATGATGAATGCTACAAAAAGTAC
GGCAACGAAAATGTTTGGAAATACTTTACTGACGTTTTCCTCTATCTCCCTCTTACTGCC
TTAATTGAATCTCAGCTTTTCTGTTTACATGGTGGTTTGTCTCCAGCTATTGAAAATCTT
GACCAAATTCGTTCTCTTAATCGTTTCTAAGAACTCCCTCACGAAGGTCCTATGTGTGAC
CTTTTATGGTCAGATCCTGATGATTAAAGAACTGGTTGGGGTCTTTCTCCTAGAGGTGCA
GGATGGACTTGGGGTCATGATATCACTGAAAAATTCATTCACTAAAATAAATTAAAGCTC
ATTGCCAGAGCTCACTAACTTGTTATGGATGGATATCAGCATGTTCATAATAAAAAGTGT
GTAACTATTTTCTCAGCACCAAATTATTGTTATAGATGTGGTAATTAGGCTTCAATTATG
GAAGTTGACGATGGTCTTAAGCTAAACTATATGTAATTCGAACCTGCTCCTAGAACAAAC
GAACCTCATGCTTCTCGTAGAGTTCCTGACTATTTCCTTTGA


>TTHERM_01345810(protein)
MPPKLTSSDLGNFDKYIEQLWQCKPLAENDVKILCDKVKEILAEENNVTTVKAPVTVCGD
IHGQFHDLIELFRIGGKPPDTNYLFMGDYVDRGSNSVETVSLIFSLKVRFKDRVTILRGN
HENREINKIYGFYDECYKKYGNENVWKYFTDVFLYLPLTALIESQLFCLHGGLSPAIENL
DQIRSLNRFQELPHEGPMCDLLWSDPDDQRTGWGLSPRGAGWTWGHDITEKFIHQNKLKL
IARAHQLVMDGYQHVHNKKCVTIFSAPNYCYRCGNQASIMEVDDGLKLNYMQFEPAPRTN
EPHASRRVPDYFL


>TTHERM_01345810(gene)
ATGCCTCCCAAACTAACTAGTAGCGATCTTGGTAATTTTGATAAGTACATTGAGCAGCTT
TGGTAATGCAAGCCATTAGCTGAAAACGATGTAAAAATATTGTGTGATAAGGTAATTATT
TTAAAGATGCTAGTCTGTATATTTAGATATTTAATCGATTTATATAGGTCAAAGAAATTT
TAGCTGAAGAAAATAATGTAACTACAGTAAAAGCACCTGTGACCGTTTGCGGTGATATCC
ATGGCTAATTCCATGATTTGATTGAACTGTTCAGAATAGGCGGTAAACCTCCTGTAAGAT
TTTTGTTTTGGTTCTATTTAAAGTTGAGGAATAAAAGCCATAAAATTTTATTTAAATAAG
GCCTTCTCTAAAAGTACGTTTTTTTTGATAGTCAGTCTTCACTTTCTTTATATTAAAGAG
AAAGAAAAAAGAAATTAAAGATTAGTTGCTTTTTTAAATATATTTAGAAGTGAAATAAAA
ATTTTAGAAAGTCCAATAATAAATTAATAAATTATATTAATTACTTGCTTCGCAAACCAA
ATAATTATTAAACTAATTATTTGTTTGTTTGTTCATTAATTCATCAAACTATTTAGAGAT
TTATTTTTACTTTTTATTTAAATTCACTAAACTAAAAAATAAATGACTGACTGACAGAAT
AACTTTTTTTAGTACTTAATTCCTTAAAACAATTTATTCCATTCGTTAGTTAATTTTTAT
TTGTTTATATTTTAGGATACTAACTATCTTTTCATGGGTGATTATGTAGATAGAGGTTCA
AATTCAGTAGAAACAGTATCCTTAATATTCTCATTAAAAGTACGCTTTAAAGATCGTGTA
ACTATTTTGAGAGGTAATCACGAAAACAGAGAAATCAATAAGATTTATGGTTTTTATGAT
GAATGCTACAAAAAGTACGGCAACGAAAATGTTTGGAAATACTTTACTGACGTTTTCCTC
TATCTCCCTCTTACTGCCTTAATTGAATCTCAGGTACTTATTTGCTTAATTACATATTTT
AATCTAATCATTCAATCATTAGTTAATTTGTTTATGCAATCACATCAAAAATGTTTTAAG
TAAATCCTATTTAAGATGGATTTTCAAGAATGATATTATGATTTGAAAATAACTAACAAA
TTTTAAGTAAAAAAATTAATATTGAAATTTTAAAAATTTAGCTTTTCTGTTTACATGGTG
GTTTGTCTCCAGCTATTGAAAATCTTGACCAAATTCGTTCTCTTAATCGTTTCTAAGAAC
TCCCTCACGAAGGTCCTATGTGTGACCTTTTATGGTCAGATCCTGATGATTAAAGAACTG
GTAATTCAAAATTAACTTACTTTTATTATAAAACTTATGTTAAAACTAATTTGATAAATT
CATATAGGTTGGGGTCTTTCTCCTAGAGGTGCAGGATGGACTTGGGGTCATGATATCACT
GAAAAATTCATTCACTAAAATAAATTAAAGCTCATTGCCAGAGCTCACTAACTTGTTATG
GATGTAATAAAATTGATAATTAATTTATAGGAACAAGCAAGATTTGAAAGAAATAAATGT
ATAATTAATATTATATAAATAAATAGGGATATCAGCATGTTCATAATAAAAAGTGTGTAA
CTATTTTCTCAGCACCAAATTATTGTTATAGATGTGGTAATTAGGCTTCAATTATGGAAG
TTGACGATGGTCTTAAGCTAAACTAGTAAATAAAATTCTAAAATTAAATTAAACAGAATT
TCTAAAAGTTTTTCAATCCAAATAATAATTAATTAATCCTTTTCTATTTACTTAAAAAAT
TAGTATGTAATTCGAACCTGCTCCTAGAACAAACGAACCTCATGCTTCTCGTAGAGTTCC
TGACTATTTCCTTTGA