Identifiers and Description

Gene Model Identifier

TTHERM_00419950

Standard Name

PPI9 (peptidylprolyl isomerase 9)

Aliases

PreTt07120 | 46.m00175 | 3679.m00025

Description

TPR Domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00515 ) tetratricopeptide repeat
  • ( PF07719 ) tetratricopeptide repeat
  • ( TIGR01563 ) phage head-tail adaptor, putative

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00419950

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11070.19.002562863449656e-100TPR Domain containing protein
(209 aa)
OxytrichaContig13524.0.g781.999790113608142e-24TPR repeat
DictyBaseDDB_G02858270.0000000020002373268528243DDB_G0285827 on chromosome: 4
position 3706474 to 3707930
SGDYJR032W0.000000009996807949091551CPR7 Peptidyl-prolyl cis-trans
isomerase (cyclophilin), cata
lyzes the cis-trans isomerizat
ion of peptide bonds N-termina
l to proline residues; binds t
o Hsp82p and contributes to ch
aperone activity
WormBaseWBGene000169660.0000029996948234116693status:Confirmed UniProt:Q18
888 protein_id:CCD68181.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00419950(coding)
ATGAGCTAAATTGAAGAAAATTCAACAACAGTTTAAAAAGATCCTACAGAATTTACACCA
ACTTCCTTTAAAGTTATTGGAAAGAGGGAAGATATTCCTGTGCTTAAAGAAATAGGATAA
AAGATTGATGAATCAAAAAGATTAAAAGAGGAAGGCAATTAGTTTTTTAAGCAAAAAGAT
TATAAAAAAGCTCTTTCTTCCTACAACAAGGCTATTTTATATGTAATCGGTTTAGTAGGT
GAAAATGATGAACACTATTAATATGGAAATGCTAGCTCGAAGCTGAACGAAGAACAAGAC
TTAATAGTAAAAGAGCTTAAATCTAGCTTATATTTAAATATTTCCTAAATTGACCTATTT
AACAAAAACTATGCAAAATGTATTGAAAGAGCAACAAAATCTCTTGACATTAAATAGACA
GCAAAGGGATACTACAGAAGAGCTATCGCTTATATGGAGCTAAACGATTTCTAGCGCTCA
TAATAAGACTTTTAAAAAAGCCTTTAATTGGACTAAACACTAGAAAAAGATATACAACAA
AAAATTTAGATATTAAAGCAAAAAGAAAAGCAAGAAGACAAAAAATCTTAAGCTTTCTAT
TCAAAAATGTTTAATTGA


>TTHERM_00419950(protein)
MSQIEENSTTVQKDPTEFTPTSFKVIGKREDIPVLKEIGQKIDESKRLKEEGNQFFKQKD
YKKALSSYNKAILYVIGLVGENDEHYQYGNASSKLNEEQDLIVKELKSSLYLNISQIDLF
NKNYAKCIERATKSLDIKQTAKGYYRRAIAYMELNDFQRSQQDFQKSLQLDQTLEKDIQQ
KIQILKQKEKQEDKKSQAFYSKMFN


>TTHERM_00419950(gene)
ATGAGCTAAATTGAAGAAAATTCAACAACAGTTTAAAAAGATCCTACAGAATTTACACCA
ACTTCCTTTAAAGTTATTGGAAAGAGGGAAGATATTCCTGTGCTTAAAGAAATAGGATAA
AAGATTGATGAATCAAAAAGATTAAAAGAGGAAGGCAATTAGTTTTTTAAGCAAAAAGAT
TATAAAAAAGCTCTTTCTTCCTACAACAAGGCTATTTTATATGTAATCGGTTTAGTAGGT
GAAAATGATGAACACTATTAATATGGAAATGCTAGCTCGAAGCTGAACGAAGAACAAGAC
TTAATAGTAAAAGAGCTTAAATCTAGCTTATATTTAAATATTTCCTAAATTGACCTATTT
AACAAAAACTATGCAAAATGTATTGAAAGAGCAACAAAATCTCTTGACATTAAATAGACA
GCAAAGGGATACTACAGAAGAGCTATCGCTTATATGGAGCTAAACGATTTCTAGCGCTCA
TAATAAGACTTTTAAAAAAGCCTTTAATTGGACTAAACACTAGAAAAAGATATACAACAA
AAAATTTAGATATTAAAGCAAAAAGAAAAGCAAGAAGACAAAAAATCTTAAGCTTTCTAT
TCAAAAATGTTTAATTGA