Identifiers and Description

Gene Model Identifier

TTHERM_00865250

Standard Name

PPI8 (peptidylprolyl isomerase 8)

Aliases

PreTt29155 | 154.m00113 | 3751.m00459

Description

PPIC-type PPIASE domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00865250

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19692.16.001756404910437e-77ppic-type ppiase domain-contai
ning protein (119 aa)
OxytrichaContig20619.0.g269.99648502569394e-38PPIC-type PPIASE domain
WormBaseWBGene000224489.997975313387782e-28locus:pinn-1 status:Confirme
d UniProt:Q9N492 protein_i
d:CCD72986.1
DictyBaseDDB_G02686186.999211576891585e-27pinA on chromosome: 1 position
1957162 to 1958072
SGDYJR017C1.0000422327488734e-24ESS1 Peptidylprolyl-cis/trans-
isomerase (PPIase) specific fo
r phosphorylated serine and th
reonine residues N-terminal to
proline; regulates phosphoryl
ation of the RNA polymerase II
large subunit (Rpo21p) C-term
inal domain
Stentor CoeruleusSteCoe_37680.000000000000004658886145103398

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00865250(coding)
ATGAACTCTTAAACAATCAGAGCTGCTCATATTTTATAAAAGCATAGAGGAAGTCGTAAT
CCACTTGATAGAGTTAGAAATGTCCAAGTTACTAGAACTTTAGATGAAGCTAAAAAAAAT
GTAGCAGCTTTCCGTGAATAGATCATGAAATCAGCTGATCCTTAAAAAACTTTTATGGAA
ATTGCACAAAAGTATTCTGAATGCACATCTGCTAGAAATGGAGGTGACTTGGGAGAGTTT
GGTCCTGGTTAAATGCAAGAATCATTTGAATAGGCTGCATATGCTCTTAAAGTCGGAGAG
ATTTCTAACTTAGTTGAGTCAGACTCTGGTGTTCACATTATTTTAAGATTAGATTGA


>TTHERM_00865250(protein)
MNSQTIRAAHILQKHRGSRNPLDRVRNVQVTRTLDEAKKNVAAFREQIMKSADPQKTFME
IAQKYSECTSARNGGDLGEFGPGQMQESFEQAAYALKVGEISNLVESDSGVHIILRLD


>TTHERM_00865250(gene)
ATGAACTCTTAAACAATCAGAGCTGCTCATATTTTATAAAAGCATAGAGGAAGTCGTAAT
CCACTTGATAGAGTTAGAAATGTCCAAGTTACTAGAACTTTAGATGAAGCTAAAAAAAAT
GTAGCAGCTTTCCGTGAATAGATCATGAAATCAGCTGATCCTTAAAAAACTTTTATGGAA
ATTGCACAAAAGTATTCTGAATGCACATCTGCTAGAAATGGAGGTGACTTGGGAGAGTTT
GGTCCTGGTTAAATGCAAGAATCATTTGAATAGGCTGCATATGCTCTTAAAGTCGGAGAG
ATTTCTAACTTAGTTGAGTCAGACTCTGGTGTTCACATTATTTTAAGATTAGATTGA