Identifiers and Description

Gene Model Identifier

TTHERM_00466090

Standard Name

PPI7 (peptidylprolyl isomerase 7)

Aliases

PreTt18613 | 55.m00168 | 3710.m00018

Description

peptidyl-prolyl cis-trans isomerase, cyclophilin-type family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF04644 ) Motilin/ghrelin
  • ( PF05391 ) Lsm interaction motif
  • ( PF00160 ) peptidyl-prolyl cis-trans isomerase, cyclophilin-type

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00466090

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14758.19.997093137033517e-262peptidyl-prolyl cis-trans isom
erase, cyclophilin-type family
protein (1741 aa)
OxytrichaContig22302.0.g1052.9993110246221282e-28Cyclophilin type peptidyl-prol
yl cis-trans isomerase/CLD
DictyBaseDDB_G02836637.999528511121947e-28ppiD on chromosome: 4 position
943186 to 944382
SGDYLR216C1.9993007828132465e-27CPR6 Peptidyl-prolyl cis-trans
isomerase (cyclophilin), cata
lyzes the cis-trans isomerizat
ion of peptide bonds N-termina
l to proline residues; binds t
o Hsp82p and contributes to ch
aperone activity
WormBaseWBGene000008779.996273942859018e-26locus:cyn-1 Peptidyl-prolyl
cis-trans isomerase 1 status
:Confirmed UniProt:P52009
protein_id:CAA22075.1
Stentor CoeruleusSteCoe_264750.00000000000009357622968840175

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00466090(coding)
ATGATAAATTTTGCTTCAAATATTACGAGTAGGTAATAAAGAGCTGCAACTCCATCAACA
GGGTCTTCGTATCTAAGATAGACCTTTTAAAGTCAAAATTCTCGCAAAATGGAAGTCCTT
ATTATAGGAAAAAATAGCGATCCAGAGCTTGAATTTATTATTTAGTAAAGCGAGCTTTGG
ATTAATAATGATACTGATTCAAATGAAGATTTGCTCTACTTTAGTGACTGTGTAGATATT
GAAATAGTAACACTACATCAAACTCATTTTGATTACATTTTAAAGGAATTGAAAAGGAAA
TCTCATGATATACTTAATCATAGTTATAACTCACCTATTATATTAATTAATTCAAGCAGA
TATGTTGAAAGCTTATTGCATCTTATTACTGTATTTGTCACTGAGCTTGGTCTCCCATAA
GAAATTTTTATTAGAAGTATACCTTATTCATTCAATTAGCAAAACGAATATTTGCTATAA
CTCACCTAAATGACTCACAGCAAGCTTCTGCAATATTTTAATTTTAGTGAGACATTTACA
TATGTCTTCTTCGACATTAAGCTTAAGAATGGATTTATTGAGTGCAATAAAAAAGTAAAG
TCTATGCACAGCATCAACATAAATATCTAAGAAGTGTAAAAAATCAATTAGTTTCGTATT
ATTATTTAACTCAATTCAAAGATTATGCCTAAAACCTGTTTAAACTTCTACCAACTTTGC
TAAGGAAATTTTAAAAACTCCAAAGGCTAGCGTCTTACATATAAAAACACTTTATTTCAT
GCCATTTAAAAAAATGCTTTCATTTAAGGTGGAGCTTTCTCTGAATTCGAAAAGGATGAA
AGCATATTTGGTCCAACATTTGAAGACGAAAATTATGCAATAAAACATGATTAACCTGGA
ATTGTTGGAATGGCTAATTAAGGTGTACCTCACACTAATGCGTCTTAATTCTATATTACT
CTTGGAGCTTAACCTGACAAAGACTAGAAATATGTAGCCTTTGGTTTAGTAGTTTATGGG
ATGAAATATCTTAGAAAACTTAATAAGATTACTGATAGATCTTCATACACTCCTGCGTTT
GAAGCTCGAATAGTTAATTGTGGTGAATATAACTTTTAAAAGGATGACTTTGTGTAGGAA
ACTAAGAAGGACTTTGACCTGCTCGATAATCTAGATTAGTTGAATAAGTAAATAAATATT
GTAAATATATCAAAGTAAGAAAGAAGCGCAAGTTCTTTGTAGTCTATTAGACCCAAAATA
GGAAATTCTGCTTAAAGTAGAATTCAAGTTAAGAAAGACAAAGATCAGTATACATCTTAA
CGAGAAAGATTCAAATCTAGTTTTCATCAATAAGAGTAAAAGAGACTCCCTTCATTATAA
AATTAGGTAGATTCACTAAATAGCTATAAAAAAATAGAGTTAGTAAAGGCTTAAGACAAA
GAGATCTTCAAACAGTATAAAAAAGAATTGGAAGACCAACCAATATTTTAATTTCATAAT
GTGAATCTATTATCTGATCGAGGCAGTGGAAATTTAGGAAATGGACACAAAAATTTTAGA
AAAACTCAATAAAAATTTTAATTTAATTCAAGTAACAATAAAAGCAATTATTTGAAATTC
TAAACTAATAGTTTAGGATTTTCTAATCATGGTAGTTTACCTAAAAATTAAATGGCTAAA
ACGAATAATGATTTCAGGAATATGCTAATTGCTCAAACCCTTTCCCCAAATATTGTTTAA
TTACCAAAAGGAAGCACAAGAAACGATATATAAAAAAATGGTGATTAATTTTTGCAGATA
TTGCTAAATAATGCGAGTGCCTTGTCAAATAATAAGAAACTAAATGGATAAAATTAAGAA
CAAAAATAAGCTCAAAATTCATCAAATTCTAATAATCACCTCGAATTAGATTAGTAACAA
TCTGATTATAACCTTGACTAAAATTTATCTGAAAGACAAGATTAATATTCAGATAATAAC
TTTGGTAGCAATCTAGCTCACACCTACTTTAAGAAGTAAACAACTCCAATAGATAGTAAT
AATCTTTTAGATTGTTTTAATGGTGGCTTGATGAACAATGGATAACAGCTACAATTTAGA
AAGCTTCCAAACATTGATAAGAATTCCACTAATAACGCAAACAGTTTTAAAAATCAAAAA
ATATAAATTGGCAGTCTTGGAAGTTTTAATGAGTTTAACAAAGATAAAATCGTCAATCAC
TCCATATAGAATATATAAAATGATATCAAAAATTTATAAACTTACATGAAATAACCTTCT
ATCAATAACAACCATATGTTTGATGACATATCTTAGAAAATTTTGATGAGTAGTAAAGAG
GAAATAGGGTCTCTCATAATTATATCGCAAATTAGTCAATTTAAGAGATTCATCGCACAT
CAGTATCAAAAAAAAGTTCAAGAAGATTAAATGCAAGAATTAACAAAGATTATACCAGGA
TTATCTGAGAGTATAGCAATGTAGCTACCTATTAGTTTAAAAAAGTCGCTTTCAACATAT
GAACAGATATTCATTAACAAATAACTAACTCAGGAATTGCTGATTCCTAAAATAGACACT
AAGAATACTGTATTTAACATGTCAAAACAGGTTGGATTCGATATATCTGAAGTGGATGAT
GATTGGTGA


>TTHERM_00466090(protein)
MINFASNITSRQQRAATPSTGSSYLRQTFQSQNSRKMEVLIIGKNSDPELEFIIQQSELW
INNDTDSNEDLLYFSDCVDIEIVTLHQTHFDYILKELKRKSHDILNHSYNSPIILINSSR
YVESLLHLITVFVTELGLPQEIFIRSIPYSFNQQNEYLLQLTQMTHSKLLQYFNFSETFT
YVFFDIKLKNGFIECNKKVKSMHSININIQEVQKINQFRIIIQLNSKIMPKTCLNFYQLC
QGNFKNSKGQRLTYKNTLFHAIQKNAFIQGGAFSEFEKDESIFGPTFEDENYAIKHDQPG
IVGMANQGVPHTNASQFYITLGAQPDKDQKYVAFGLVVYGMKYLRKLNKITDRSSYTPAF
EARIVNCGEYNFQKDDFVQETKKDFDLLDNLDQLNKQINIVNISKQERSASSLQSIRPKI
GNSAQSRIQVKKDKDQYTSQRERFKSSFHQQEQKRLPSLQNQVDSLNSYKKIELVKAQDK
EIFKQYKKELEDQPIFQFHNVNLLSDRGSGNLGNGHKNFRKTQQKFQFNSSNNKSNYLKF
QTNSLGFSNHGSLPKNQMAKTNNDFRNMLIAQTLSPNIVQLPKGSTRNDIQKNGDQFLQI
LLNNASALSNNKKLNGQNQEQKQAQNSSNSNNHLELDQQQSDYNLDQNLSERQDQYSDNN
FGSNLAHTYFKKQTTPIDSNNLLDCFNGGLMNNGQQLQFRKLPNIDKNSTNNANSFKNQK
IQIGSLGSFNEFNKDKIVNHSIQNIQNDIKNLQTYMKQPSINNNHMFDDISQKILMSSKE
EIGSLIIISQISQFKRFIAHQYQKKVQEDQMQELTKIIPGLSESIAMQLPISLKKSLSTY
EQIFINKQLTQELLIPKIDTKNTVFNMSKQVGFDISEVDDDW


>TTHERM_00466090(gene)
ATGATAAATTTTGCTTCAAATATTACGAGTAGGTAATAAAGAGCTGCAACTCCATCAACA
GGGTCTTCGTATCTAAGATAGACCTTTTAAAGTCAAAATTCTCGCAAAATGGAAGTCCTT
ATTATAGGAAAAAATAGCGATCCAGAGCTTGAATTTATTATTTAGTAAAGCGAGCTTTGG
ATTAATAATGATACTGATTCAAATGAAGATTTGCTCTACTTTAGTGACTGTGTAGATATT
GAAATAGTAACACTACATCAAACTCATTTTGATTACATTTTAAAGGAATTGAAAAGGAAA
TCTCATGATATACTTAATCATAGTTATAACTCACCTATTATATTAATTAATTCAAGCAGA
TATGTTGAAAGCTTATTGCATCTTATTACTGTATTTGTCACTGAGCTTGGTCTCCCATAA
GAAATTTTTATTAGAAGTATACCTTATTCATTCAATTAGCAAAACGAATATTTGCTATAA
CTCACCTAAATGACTCACAGCAAGCTTCTGCAATATTTTAATTTTAGTGAGACATTTACA
TATGTCTTCTTCGACATTAAGCTTAAGAATGGATTTATTGAGTGCAATAAAAAAGTAAAG
TCTATGCACAGCATCAACATAAATATCTAAGAAGTGTAAAAAATCAATTAGTTTCGTATT
ATTATTTAACTCAATTCAAAGATTATGCCTAAAACCTGTTTAAACTTCTACCAACTTTGC
TAAGGAAATTTTAAAAACTCCAAAGGCTAGCGTCTTACATATAAAAACACTTTATTTCAT
GCCATTTAAAAAAATGCTTTCATTTAAGGTGGAGCTTTCTCTGAATTCGAAAAGGATGAA
AGCATATTTGGTCCAACATTTGAAGACGAAAATTATGCAATAAAACATGATTAACCTGGA
ATTGTTGGAATGGCTAATTAAGGTGTACCTCACACTAATGCGTCTTAATTCTATATTACT
CTTGGAGCTTAACCTGACAAAGACTAGAAATATGTAGCCTTTGGTTTAGTAGTTTATGGG
ATGAAATATCTTAGAAAACTTAATAAGATTACTGATAGATCTTCATACACTCCTGCGTTT
GAAGCTCGAATAGTTAATTGTGGTGAATATAACTTTTGTAATTTATTAAATTATCCTTTA
TGATATAGACAAAAAGCATTTATTTAGTTTTGTTAGTTTCATTATTTTTAAAAAATATCG
CCTTTAAACGAATGTTAGCAATTTCTCTCTCATTAAATTTGATTTTATTAAAGAAAAGGA
TGACTTTGTGTAGGAAACTAAGAAGGACTTTGACCTGCTCGATAATCTAGATTAGTTGAA
TAAGTAAATAAATATTGTAAATATATCAAAGTAAGAAAGAAGCGCAAGTTCTTTGTAGTC
TATTAGACCCAAAATAGGAAATTCTGCTTAAAGTAGAATTCAAGTTAAGAAAGACAAAGA
TCAGTATACATCTTAACGAGAAAGATTCAAATCTAGTTTTCATCAATAAGAGTAAAAGAG
ACTCCCTTCATTATAAAATTAGGTAGATTCACTAAATAGCTATAAAAAAATAGAGTTAGT
AAAGGCTTAAGACAAAGAGATCTTCAAACAGTATAAAAAAGAATTGGAAGACCAACCAAT
ATTTTAATTTCATAATGTGAATCTATTATCTGATCGAGGCAGTGGAAATTTAGGAAATGG
ACACAAAAATTTTAGAAAAACTCAATAAAAATTTTAATTTAATTCAAGTAACAATAAAAG
CAATTATTTGAAATTCTAAACTAATAGTTTAGGATTTTCTAATCATGGTAGTTTACCTAA
AAATTAAATGGCTAAAACGAATAATGATTTCAGGAATATGCTAATTGCTCAAACCCTTTC
CCCAAATATTGTTTAATTACCAAAAGGAAGCACAAGAAACGATATATAAAAAAATGGTGA
TTAATTTTTGCAGATATTGCTAAATAATGCGAGTGCCTTGTCAAATAATAAGAAACTAAA
TGGATAAAATTAAGAACAAAAATAAGCTCAAAATTCATCAAATTCTAATAATCACCTCGA
ATTAGATTAGTAACAATCTGATTGTAAATAGATATTTTGTCTTTTTTAATTCTACTAAAA
AAGAAACATAATTAAATTCGAACTCTTATTTATTTTATTATAAATCAGCAAGTTATATTT
TTGTTTTTTTTTAAATAAATAGATAACCTTGACTAAAATTTATCTGAAAGACAAGATTAA
TATTCAGATAATAACTTTGGTAGCAATCTAGCTCACACCTACTTTAAGAAGTAAACAACT
CCAATAGATAGTAATAATCTTTTAGATTGTTTTAATGGTGGCTTGATGAACAATGGATAA
CAGCTACAATTTAGAAAGCTTCCAAACATTGATAAGAATTCCACTAATAACGCAAACAGT
TTTAAAAATCAAAAAATATAAATTGGCAGTCTTGGAAGTTTTAATGAGTTTAACAAAGAT
AAAATCGTCAATCACTCCATATAGAATATATAAAATGATATCAAAAATTTATAAACTTAC
ATGAAATAACCTTCTATCAATAACAACCATATGTTTGATGACATATCTTAGAAAATTTTG
ATGAGTAGTAAAGAGGAAATAGGGTCTCTCATAATTATATCGCAAATTGTAATTAATACA
TTCAAAAATCATTCATTAAAATCCTTATTAATATTAAGAGTCAATTTAAGAGATTCATCG
CACATCAGTATCAAAAAAAAGTTCAAGAAGATTAAATGCAAGAATTAACAAAGATTATAC
CAGGTATAAATTAATCAAATAATTTTACTATCCTTAATATTTAACTATATCAATAGGATT
ATCTGAGAGTATAGCAATGTAGCTACCTATTAGTTTAAAAAAGTCGCTTTCAACATATGA
ACAGATATTCATTAACAAATAACTAACTCAGGAATTGCTGATTCCTAAAATAGACACTAA
GAATACTGTATTTAACATGTCAAAACAGGTAAATTTTAATATTTAAAAATTTTATAGTTA
AAAATTATTTTCTATAGGTTGGATTCGATATATCTGAAGTGGATGATGATTGGTGA