Identifiers and Description

Gene Model Identifier

TTHERM_01075610

Standard Name

PPI6 (peptidylprolyl isomerase 6)

Aliases

PreTt02673 | 219.m00026

Description

TPR Domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00515 ) tetratricopeptide repeat
  • ( PF07719 ) tetratricopeptide repeat
  • ( PF07720 ) Tetratricopeptide repeat
  • ( TIGR03302 ) outer membrane assembly lipoprotein YfiO

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01075610

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15343.14.001242549923285e-107TPR Domain containing protein
(289 aa)
OxytrichaContig16488.0.g431.0002869940498747e-21TPR repeat
DictyBaseDDB_G02858279.997764199084386e-16DDB_G0285827 on chromosome: 4
position 3706474 to 3707930
SGDYLR216C0.0000000000019997478866288316CPR6 Peptidyl-prolyl cis-trans
isomerase (cyclophilin), cata
lyzes the cis-trans isomerizat
ion of peptide bonds N-termina
l to proline residues; binds t
o Hsp82p and contributes to ch
aperone activity
WormBaseWBGene000169660.0000000400154582995175status:Confirmed UniProt:Q18
888 protein_id:CCD68181.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01075610(coding)
ATGAGTCTATTCCTTAAAAGAATAATATGTTTGAATTAAAATTTAAGAGGATTACATAAA
GGAATAGATAGTCTTTTAATTCTAACTTTCCAATCGAACAATAGAAGAATTTATTAAATT
ATATTTAATTAGTTAATACTTTTTGATATGCTGTATCAACAAATTAAATTTCATTTAAAT
TATATTTATAAAAGAAGTAAATTAGTCAATTAATTAATAAATTTATAAGTAGGCTATATT
AAATAAATGTCACAGTCATCATCCTCTCATTCCTTAGAATAAGATCAAGAAGAGCAATAA
GACGATTACAAAATGCCCCCTACAATTGATTTAAGCAATGGCAGACTCAAACAAAAAGAA
GAAGAATAAAATAAGCTGATTGAGGGTTAGGAGGTAGTTGATAGCTACGAAAATATGGAT
AGATTGTAAGTGCCAGAGTATGAAAAAAATAAAGGCAAAGAAGCATTCTAAAAATAGAAT
TACCAAGCAGCTGTAAAACACTACTCAAAAGCTCTGCTGGCTCTTTAGTTTTTAATCAAG
GATGGCCAAATAAAATAAAAAGAATAAATGGTGAAGTTCATAGAAGACATTGAAATTCCA
TGCAATTCAAATTTATCAATCTGCAATTTAAAGCTAAAAGAATATAAGCAATGTATTCAC
TTTGCTTCAAAAGTTATAGAAAATGACCCAAATAATATAAAATGCTTATATAGAAGAGGT
ATGGCTCATCTTTACTTAAATGAATTTGATGATGCTAGAAACGATTTTAAAACAGCTTAT
GCACTTGACCCCAATAGCAAAGAACTTTAGTTAGCATTCGAATAGTTATAATCTTGA


>TTHERM_01075610(protein)
MSLFLKRIICLNQNLRGLHKGIDSLLILTFQSNNRRIYQIIFNQLILFDMLYQQIKFHLN
YIYKRSKLVNQLINLQVGYIKQMSQSSSSHSLEQDQEEQQDDYKMPPTIDLSNGRLKQKE
EEQNKLIEGQEVVDSYENMDRLQVPEYEKNKGKEAFQKQNYQAAVKHYSKALLALQFLIK
DGQIKQKEQMVKFIEDIEIPCNSNLSICNLKLKEYKQCIHFASKVIENDPNNIKCLYRRG
MAHLYLNEFDDARNDFKTAYALDPNSKELQLAFEQLQS


>TTHERM_01075610(gene)
ATGAGTCTATTCCTTAAAAGAATAATATGTTTGAATTAAAATTTAAGAGGATTACATAAA
GGAATAGATAGTCTTTTAATTCTAACTTTCCAATCGAACAATAGAAGAATTTATTAAATT
ATATTTAATTAGTTAATACTTTTTGATATGCTGTATCAACAAATTAAATTTCATTTAAAT
TATATTTATAAAAGAAGTAAATTAGTCAATTAATTAATAAATTTATAAGTAGGCTATATT
AAATAAATGTCACAGTCATCATCCTCTCATTCCTTAGAATAAGATCAAGAAGAGCAATAA
GACGATTACAAAATGCCCCCTACAATTGATTTAAGCAATGGCAGACTCAAACAAAAAGAA
GAAGAATAAAATAAGCTGATTGAGGGTTAGGAGGTAGTTGATAGCTACGAAAATGTAAAA
TACAATTTGATTTAGATGTTCGATTTTTATTTTACTTATTGACTTTTAAAAGATGGATAG
ATTGTAAGTGCCAGAGTATGAAAAAAATAAAGGCAAAGAAGCATTCTAAAAATAGAATTA
CCAAGCAGCTGTAAAACACTACTCAAAAGTAACTCAACTTAAACTTTTAGCATATCTAAA
TAAATAAATATATTAAAAATAGGCTCTGCTGGCTCTTTAGTTTTTAATCAAGGATGGCCA
AATAAAATAAAAAGAATAAATGGTGAAGTTCATAGAAGACATTGAAGTAATTATATAATT
CTATAATGAGCTAATTTTAATATAAATTGTTGTTAATAATAAAGATTCCATGCAATTCAA
ATTTATCAATCTGCAATTTAAAGCTAAAAGAATATAAGCAATGTATTCACTTTGCTTCAA
AAGTTATAGAAAATGACCCAAATAATATAAAATGCTTATATAGAAGAGGTATGGCTCATC
TTTACTTAAATGAAGTAATAAAATAAATATTATTTTGATTAATTACTTTAAAAATAAACA
TTAAACTATAAAAGTTTGATGATGCTAGAAACGATTTTAAAACAGCTTATGCACTTGACC
CCAATAGCAAAGAACTTTAGTTAGCATTCGAATAGTTGTAAATAAGAAAATAGCAAGTAG
CTGAAAAGTAGAAGTAAATCAGCAAGAGAATGTTAGATAATCTTGA