Identifiers and Description

Gene Model Identifier

TTHERM_00243800

Standard Name

PPI5 (peptidylprolyl isomerase 5)

Aliases

PreTt02375 | 21.m00206

Description

peptidyl-prolyl cis-trans isomerase, cyclophilin-type family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00160 ) peptidyl-prolyl cis-trans isomerase, cyclophilin-type

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00243800

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19462.13.999284652801983e-113peptidyl-prolyl cis-trans isom
erase, cyclophilin-type family
protein (189 aa)
WormBaseWBGene000008833.999031314999233e-77locus:cyn-7 Peptidyl-prolyl
cis-trans isomerase 7 status
:Confirmed UniProt:P52015
protein_id:CAA21760.1
DictyBaseDDB_G02823598.002162267243937e-73ppiA on chromosome: 3 position
5684660 to 5685426
SGDYDR155C9.997863464222902e-69CPR1 Cytoplasmic peptidyl-prol
yl cis-trans isomerase (cyclop
hilin), catalyzes the cis-tran
s isomerization of peptide bon
ds N-terminal to proline resid
ues; binds the drug cyclospori
n A
OxytrichaContig22608.0.g346.997942222381785e-66Cyclophilin type peptidyl-prol
yl cis-trans isomerase/CLD
Stentor CoeruleusSteCoe_277464.906094730649281e-35

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00243800(coding)
ATGAACGTTTTCAAGCTTATTAGTAAATTTTCTTCTTCAAAGAACCCTAAGGTTTTCTTT
GATATGGCTATAAATGGTAATCCTAGCGGAAGAATGGTCTTTGAGCTTTATGCTGATGTT
GTCCCAAAGACTGCTGAAAACTTCAGAAGACTTTGCATCGGAGATGCCAAGTCTGTTACT
AGTGGTAAACCTTTGACCTATAAAGGTAGTATTTTCCATAGAATTATTCCTAGATTTATG
TGCTAGGGAGGTGATATTACTCACCATAACGGAATGGGTGGTGAATCTATTTATGGAAGA
AAATTCCCTGATGAAAACTTTAAATTGAATCACACTGGTCCTGGTATTTTATCTATGGCT
AATTCTGGTCCTAACTCTAATGGATCATAATTCTTTATCACAACAGTACCCTGTGATTGG
TTAGATGGCAAGCATGTAGTATTCGGAAAGCTCATTTAGGGTCAAGAAGTCCTCTCTCTC
TGCGAATAATAAGGTAGATCTAACGGATAAACCAAATCCGTTGTTACTGTTACTGATTGC
GGTGAAATTTCTGCTGAAAAATAATAGTGA


>TTHERM_00243800(protein)
MNVFKLISKFSSSKNPKVFFDMAINGNPSGRMVFELYADVVPKTAENFRRLCIGDAKSVT
SGKPLTYKGSIFHRIIPRFMCQGGDITHHNGMGGESIYGRKFPDENFKLNHTGPGILSMA
NSGPNSNGSQFFITTVPCDWLDGKHVVFGKLIQGQEVLSLCEQQGRSNGQTKSVVTVTDC
GEISAEKQQ


>TTHERM_00243800(gene)
TTAATTAAATCTTTAATAATCAATTAATATTAATTCATTAATATATATCAATAAATTTAC
ATAGCAAATAAATAAATGAACGTTTTCAAGCTTATTAGTAAATTTTCTTCTTCAAAGAAC
CCTAAGGTTTTCTTTGATATGGCTATAAATGGTAATCCTAGCGGAAGAATGGTCTTTGAG
GTATTAAATATTTAAATACAAAAGGAACTTACTTGAAATATCATTTATGATAAATAATTA
TATAGCTTTATGCTGATGTTGTCCCAAAGACTGCTGAAAACTTCAGAAGACTTTGCATCG
GAGATGCCAAGTCTGTTACTAGTGGTAAACCTTTGACCTATAAAGGTAGTATTTTCCATA
GAATTATTCCTAGATTTATGTGCTAGGGAGGTGATATTACTCACCATAACGGAATGGGTA
AAAAATTTATAATATAAAATTAAACATATGAGATCTGATAATATAGATTTTATTTTTAAA
ATCTCGCGATTCATTAACATTTTAACAAATTTTCTTTCTATTAAAAGGTGGTGAATCTAT
TTATGGAAGAAAATTCCCTGATGAAAACTTTAAATTGAATCACACTGGTCCTGGTATGAA
AAGCTTAAACATATTTTACTATTTATATTTCAAAGATCGTCTAAAAGAAATTAAACTTTC
TACCAAAAAATTAGAATTTAAATAAAGAATTTTCTACATTATTGCCAAATTTTAGATTAT
AAAACATCAAATATTATTTTATAGGTATTTTATCTATGGCTAATTCTGGTCCTAACTCTA
ATGGATCATAATTCTTTATCACAACAGTACCCTGTGATTGGTTAGATGGCAAGCATGTAG
TATTCGGAAAGCTCATTTAGGGTCAAGAAGTCCTCTCTCGTATCTTTTTATTTAGATTTG
AAATATATTAAAAAATTCTTAAAATTATTTATTCTATACTAATAGTCTGCGAATAATAAG
GTAGATCTAACGGATAAACCAAATCCGTTGTTACTGTTACTGATTGCGGTGAAATTTCTG
CTGAAAAATAATAGTGA