Identifiers and Description

Gene Model Identifier

TTHERM_00538480

Standard Name

PPI4 (peptidylprolyl isomerase 4)

Aliases

PreTt12106 | 70.m00102 | 3728.m00002

Description

peptidyl-prolyl cis-trans isomerase, cyclophilin-type family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00160 ) peptidyl-prolyl cis-trans isomerase, cyclophilin-type

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00538480

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18186.19.001220950889699e-110peptidyl-prolyl cis-trans isom
erase, cyclophilin-type family
protein (164 aa)
DictyBaseDDB_G02917341.000296925633081e-74ppil3 on chromosome: 6 positio
n 672553 to 673128
WormBaseWBGene000008866.00265115378362e-67locus:cyn-10 Peptidyl-prolyl
cis-trans isomerase 10 stat
us:Confirmed UniProt:P52017
protein_id:CCD61542.1
OxytrichaContig22430.0.g846.001629673589058e-65Cyclophilin type peptidyl-prol
yl cis-trans isomerase/CLD
SGDYHR057C6.99868990988981e-32CPR2 Peptidyl-prolyl cis-trans
isomerase (cyclophilin), cata
lyzes the cis-trans isomerizat
ion of peptide bonds N-termina
l to proline residues; has a p
otential role in the secretory
pathway
Stentor CoeruleusSteCoe_31181.5628821893349888e-18

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00538480(coding)
ATGTCAGTAACTTTGCATACTACGCACGGAGAACTAAAAATTGAAGTATTTTGTGAAAAA
ACTCCAAATGCTGCTAAAAATTTTTTAGCTTTGTGCGCTAGAGGAGATTATAATGGAACA
ATATTCCATAGAAATATAAAAGGGTTTATTATTTAAGGTGGTGATCCTACTAATACAGGA
AAAGGAGGATAAAGTATTTATGGAAAGCCATTTAATGATGAAATTAAAGAAGATATTAAG
CATGATAAAAGAGGAATGTTAAGCATGGCTAACTCAGGTCCAAATACTAATTTATCTTAA
TTTTTTATCCTTTATTCTAAATAAAATCACTTAAATGGATCATATACAATTTTTGGTAAA
GTTATTGATGGCTGGGAGGCCTTAGACTTAATGGAAAAAGAACCAATAGATGCAAACGAT
AGACCACTAAACGAAATAAAAATAAATAAAGTAACAATACACGCAAATCCAATTGCAGAC
TTCGAAGAATGA


>TTHERM_00538480(protein)
MSVTLHTTHGELKIEVFCEKTPNAAKNFLALCARGDYNGTIFHRNIKGFIIQGGDPTNTG
KGGQSIYGKPFNDEIKEDIKHDKRGMLSMANSGPNTNLSQFFILYSKQNHLNGSYTIFGK
VIDGWEALDLMEKEPIDANDRPLNEIKINKVTIHANPIADFEE


>TTHERM_00538480(gene)
ATGTCAGTAACTTTGCATACTACGCACGGAGAACTAAAAATTGAAGTATTTTGTGAAAAA
ACTCCAAATGCTGCTAAAAATTTTTTAGCTTTGTGCGCTAGAGGAGATTATAATGGAACA
ATATTCCATAGAAATATAAAAGGGTTTATTATTTAAGGTGGTGATCCTACTAATACAGGA
AAAGGAGGATAAAGTATTTATGGAAAGCCATTTAATGATGAAATTAAAGAAGATATTAAG
CATGATAAAAGAGGAATGTTAAGCATGGCTAACTCAGGTCCAAATACTAATTTATCTTAA
TTTTTTATCCTTTATTCTAAATAAAATCACTTAAATGGATCATATACAATTTTTGGTAAA
GTTATTGATGGCTGGGAGGCCTTAGACTTAATGGAAAAAGAACCAATAGATGCAAACGAT
AGACCACTAAACGAAATAAAAATAAATAAAGTAACAATACACGCAAATCCAATTGCAGAC
TTCGAAGAATGA