Identifiers and Description

Gene Model Identifier

TTHERM_00757550

Standard Name

PPI3 (peptidylprolyl isomerase 3)

Aliases

PreTt08151 | 124.m00069 | 3821.m00489

Description

cyclophilin-RNA interacting protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00757550

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20865.19.997093137033517e-262cyclophilin-RNA interacting pr
otein (540 aa)
DictyBaseDDB_G02927102.9986702110910746e-96DDB_G0292710 on chromosome: 6
position 1995447 to 1997098
WormBaseWBGene000008905.99792543404391e-93locus:sig-7 status:Confirmed
UniProt:G5EEW6 protein_id
:CAB03088.2
OxytrichaContig12239.0.g704.0006908853687255e-76Cyclophilin type peptidyl-prol
yl cis-trans isomerase/CLD
Stentor CoeruleusSteCoe_160931.8521167695179754e-45
SGDYML078W0.000000000004997916451710233CPR3 Mitochondrial peptidyl-pr
olyl cis-trans isomerase (cycl
ophilin), catalyzes the cis-tr
ans isomerization of peptide b
onds N-terminal to proline res
idues; involved in protein ref
olding after import into mitoc
hondria

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00757550(coding)
ATGTCTTTAATTATAGAAACGTCGTTAGGCGATTTAGAAGTAGATTTATTTGTTTAGAAA
GCACCTGAAATAAGCAAAAACTTTTTAAAGTTATGCAAGCTTAAACATTACAACAATGCC
CTTTTTTATGAAGTTTAAAAGAATTACTTAACATCAATTAAATCAAAGAAAGCAACCACT
GTTTTTGTTGAAACAGGAGGAGATCAGTAATATATTCATGATGAAATAGATCCTACCAAT
AAACACAATAAAATTGGGTTGCTTTCAACTTCAAATATAGGCTAGGATAGAAATACTTCC
GAATTTTTTATAACTTTGACGAGCTCTCATTTATAACATTTTGATGAAAAGCACACTATT
TTTGGCTAGGTTTAAGTAGGCATTGATATACTTGAAAAATTCAACACAGATGTAATCGTA
GACAATGATAATAAACCTTACATAAATCATAGAATTCTACATACTATAGTTATTGATGAT
CCATTTGAAGATCCAGAAAATTTAGTAGAGCCTGATTAATCGCCTCTGCCAATAGAAAAG
AGTGACAATGATAGACTAGAATTTTATGAAAAGGAGAAAATTTTAAATGAATCAGACAAA
ACAGAGGAAGAAATTATTGAAGAAGCCAAATTATAAATTTAAAAGATGAGGGAAATCAAA
CTTCAAATGATTGGTGATATTCCTGATGCAGACATGAGACCACCTGAAAACGTTTTATTT
GTTTGTTAACTAAATCCTGTGACTTAAGAAAGAGATTTGGAAATTATATTCTCTAGGTTT
GGAGTTATTACTAGATGCGAAGTTGTTAGAGATTGGAAGACAGGTTAATCATTGCAATAT
GCGTTTATAGAGTTTGAAACTGAAAAGTCTTGTCAAGAAGCATACTTTAAAATGAAAGGA
GCCCTTATTGATGAAAGAAGAGTTCATGTTGATTTTTGTTAAAGTCTTTAAAAATTTAAG
AATAATAAAAAGCCCAACCAAAATTAAAGCAATAAAAAGCTTGAAACATCATTTGAAAAC
ATAGAGTTTTCTAAATTTTATAGAAATAACAACTATAACACATCAAAGCATAAAATGGTA
TTTGATTAAGGTGAGGATAAATATGCTAATAAGAAAGAGAGATTAGACTCATTTAAGGAA
AGAGAAAGAGAAAGGTACAGAAACAATAGAAAAGAATAAGAGAATAGAAGTGATAGTAGT
AAATAAGATGAAAATTTAAATCATCATCAGCACAAAAGGAGAAATGATTCACGTTCTTAA
GAAAAAGATGATACTGAATATGAAAGTAGACACTCAAAAAAAGATAGAAAAAGAAGCCAT
AGTAATGAAAGATAGGAAAGGAAATAGGGTAATAAAGATAGAAAAAGAAGTGATAGTAGA
GATAAAAAGAGAGAAAAAAATAGAAGCAACAGCAGAGATAGAAAAAGAAATAGTAAAAGT
AGAGAAAGAAGGAGTGCTAGTAAGGAAAAAAAGAGAAAGAGATCTCTCTCTCCTTCAAGA
ACATATTCGAGATCATCTGTATCTGCCAGCAGAAAAGATAAAAATAGAGACAGAAAGCAC
GATTCCAAAAGAGACAGAAGCAGAAGTTAAAAAAAGAAAGACAAAAAGCAAAAATGA


>TTHERM_00757550(protein)
MSLIIETSLGDLEVDLFVQKAPEISKNFLKLCKLKHYNNALFYEVQKNYLTSIKSKKATT
VFVETGGDQQYIHDEIDPTNKHNKIGLLSTSNIGQDRNTSEFFITLTSSHLQHFDEKHTI
FGQVQVGIDILEKFNTDVIVDNDNKPYINHRILHTIVIDDPFEDPENLVEPDQSPLPIEK
SDNDRLEFYEKEKILNESDKTEEEIIEEAKLQIQKMREIKLQMIGDIPDADMRPPENVLF
VCQLNPVTQERDLEIIFSRFGVITRCEVVRDWKTGQSLQYAFIEFETEKSCQEAYFKMKG
ALIDERRVHVDFCQSLQKFKNNKKPNQNQSNKKLETSFENIEFSKFYRNNNYNTSKHKMV
FDQGEDKYANKKERLDSFKERERERYRNNRKEQENRSDSSKQDENLNHHQHKRRNDSRSQ
EKDDTEYESRHSKKDRKRSHSNERQERKQGNKDRKRSDSRDKKREKNRSNSRDRKRNSKS
RERRSASKEKKRKRSLSPSRTYSRSSVSASRKDKNRDRKHDSKRDRSRSQKKKDKKQK


>TTHERM_00757550(gene)
ATGTCTTTAATTATAGAAACGTCGTTAGGCGATTTAGAAGTAGATTTATTTGTTTAGAAA
GCACCTGAAATAAGCAAAAACTTTTTAAAGTTATGCAAGCTTAAACATTACAACAATGCC
CTTTTTTATGAAGTTTAAAAGAATTACTTAACATCAATTAAATCAAAGAAAGCAACCACT
GTTTTTGTTGAAACAGGAGGAGATCAGTAATATATTCATGATGAAATAGATCCTACCAAT
AAACACAATAAAATTGGGTTGCTTTCAACTTCAAATATAGGCTAGGATAGAAATACTTCC
GAATTTTTTATAACTTTGACGAGCTCTCATTTATAACATTTTGATGAAAAGCACACTATT
TTTGGCTAGGTTTAAGTAGGCATTGATATACTTGAAAAATTCAACACAGATGTAATCGTA
GACAATGATAATAAACCTTACATAAATCATAGAATTCTACATACTATAGTTATTGATGAT
CCATTTGAAGATCCAGAAAATTTAGTAGAGCCTGATTAATCGCCTCTGCCAATAGAAAAG
AGTGACAATGATAGACTAGAATTTTATGAAAAGGAGAAAATTTTAAATGAATCAGACAAA
ACAGAGGAAGAAATTATTGAAGAAGCCAAATTATAAATTTAAAAGATGAGGGAAATCAAA
CTTCAAATGATTGGTGATATTCCTGATGCAGACATGAGACCACCTGAAAACGTTTTATTT
GTTTGTTAACTAAATCCTGTGACTTAAGAAAGAGATTTGGAAATTATATTCTCTAGGTTT
GGAGTTATTACTAGATGCGAAGTTGTTAGAGATTGGAAGACAGGTTAATCATTGCAATAT
GCGTTTATAGAGTTTGAAACTGAAAAGTCTTGTCAAGAAGCATACTTTAAAATGAAAGGA
GCCCTTATTGATGAAAGAAGAGTTCATGTTGATTTTTGTTAAAGTCTTTAAAAATTTAAG
AATAATAAAAAGCCCAACCAAAATTAAAGCAATAAAAAGCTTGAAACATCATTTGAAAAC
ATAGAGTTTTCTAAATTTTATAGAAATAACAACTATAACACATCAAAGCATAAAATGGTA
TTTGATTAAGGTGAGGATAAATATGCTAATAAGAAAGAGAGATTAGACTCATTTAAGGAA
AGAGAAAGAGAAAGGTACAGAAACAATAGAAAAGAATAAGAGAATAGAAGTGATAGTAGT
AAATAAGATGAAAATTTAAGTAATTTAAACAAAACATAAATTAAATTTGTAAAAATAAAT
GCATTTTAATTAAAAATAGATCATCATCAGCACAAAAGGAGAAATGATTCACGTTCTTAA
GAAAAAGATGATACTGAATATGAAAGTAGACACTCAAAAAAAGATAGAAAAAGAAGCCAT
AGTAATGAAAGATAGGAAAGGAAATAGGGTAATAAAGATAGAAAAAGAAGTGATAGTAGA
GATAAAAAGAGAGAAAAAAATAGAAGCAACAGCAGAGATAGAAAAAGAAATAGTAAAAGT
AGAGAAAGAAGGAGTGCTAGTAAGGAAAAAAAGAGAAAGAGATCTCTCTCTCCTTCAAGA
ACATATTCGAGATCATCTGTATCTGCCAGCAGAAAAGATAAAAATAGAGACAGAAAGCAC
GATTCCAAAAGAGACAGAAGCAGAAGTTAAAAAAAGAAAGACAAAAAGCAAAAATGA