Identifiers and Description

Gene Model Identifier

TTHERM_00227060

Standard Name

PPI21 (peptidylprolyl isomerase 21)

Aliases

PreTt12516 | 19.m00308

Description

FKBP12 binding protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00254 ) peptidyl-prolyl cis-trans isomerase, FKBP-type

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00227060

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05518.18.997777707990486e-82FKBP12 binding protein (134 aa
)
OxytrichaContig18830.0.g954.001118334825066e-42FKBP-type peptidyl-prolyl cis-
trans isomerase
SGDYNL135C1.0002335610448659e-38FPR1 Peptidyl-prolyl cis-trans
isomerase (PPIase), binds to
the drugs FK506 and rapamycin;
also binds to the nonhistone
chromatin binding protein Hmo1
p and may regulate its assembl
y or function
DictyBaseDDB_G02752271.0000633497921574e-36DDB_G0275227 on chromosome: 2
position 4935740 to 4936447
WormBaseWBGene000014274.000054831110256e-33locus:fkb-2 Peptidyl-prolyl
cis-trans isomerase status:C
onfirmed UniProt:Q9U2Q8 pr
otein_id:CAA22330.1
Stentor CoeruleusSteCoe_241134.248354255291589e-18

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00227060(coding)
ATGTATGATATTTTGATTAAATTGAAGACGTAGATTAGATAGTACGATAAAAAAATTATA
TATATTATTCAGAAAATCATTCAAAATTTAAATAAAATGAATAAATTATTATAAACAGCT
ATTACAAGATCAACTTTCTTCGCAAAGCAATCCCGTTTTTCAACTACCCCTGATTAGTTC
AGTGTTGTAACTAAGAAGGCTGGTGATAATACCAACTACCCAAAAAATGGTGACAAGGTA
ACTGTTCATTACGTAGGAACTTTTACAGATGGCAAAAAGTTTGATTCTTCTAGAGATAGA
AATTAACCTTTCTAATTTATTTTAGGTGCTGGTTAAGTTATTAGAGGATGGGATGAAGGA
GTAGGTAAATTAAGTCTTGGTGAAGTTGCCACCATTACTTGCCCTTATTAATATGCTTAT
GGCGAAAGAGGTTATCCTGGTGTTATCCCTCCTAAGGCCACTCTCCTTTTCGAAGTCGAA
CTTCTTAGCTTCAAGAAATGA


>TTHERM_00227060(protein)
MYDILIKLKTQIRQYDKKIIYIIQKIIQNLNKMNKLLQTAITRSTFFAKQSRFSTTPDQF
SVVTKKAGDNTNYPKNGDKVTVHYVGTFTDGKKFDSSRDRNQPFQFILGAGQVIRGWDEG
VGKLSLGEVATITCPYQYAYGERGYPGVIPPKATLLFEVELLSFKK


>TTHERM_00227060(gene)
ATGTATGATATTTTGATTAAATTGAAGACGTAGATTAGATAGTACGATAAAAAAATTATA
TATATTATTCAGAAAATCATTCAAAATTTAAATAAAATGAATAAATTATTATAAACAGCT
ATTACAAGATCAACTTTCTTCGCAAAGCAATCCCGTTTTTCAACTACCCCTGATTAGTTC
AGTGTTGTAACTAAGAAGGCTGGTGATAATACCAACTACCCAAAAAATGGTGACAAGGTA
ACTGTTCATTACGTAGGAACTTTTACAGATGGCAAAAAGTTTGATTCTTCTAGAGATAGA
AATTAACCTTTCTAATTTATTTTAGGTGCTGGTTAAGTTATTAGAGGATGGGATGAAGGA
GTAGGTAAATTAAGTCTTGGTGAAGTTGCCACCATTACTTGCCCTTATTAATATGCTTAT
GGCGAAAGAGGTTATCCTGGTGTTATCCCTCCTAAGGCCACTCTCCTTTTCGAAGTCGAA
CTTCTTAGCTTCAAGAAATGA