Identifiers and Description

Gene Model Identifier

TTHERM_00548130

Standard Name

PPI2 (peptidylprolyl isomerase 2)

Aliases

PreTt15062 | 71.m00189 | 3729.m00066

Description

peptidyl-prolyl cis-trans isomerase, cyclophilin-type family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

  • proton-transporting two-sector ATPase complex, catalytic domain (IEA) | GO:0033178

Molecular Function

  • peptidyl-prolyl cis-trans isomerase activity (IEA) | GO:0003755
  • hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances (IEA) | GO:0016820

Biological Process

Domains

  • ( PF00515 ) tetratricopeptide repeat
  • ( PF07719 ) tetratricopeptide repeat
  • ( TIGR01026 ) ATPase FliI/YscN family
  • ( TIGR01040 ) V-type ATPase, B subunit
  • ( PF06324 ) Pigment-dispersing hormone (PDH)
  • ( TIGR00019 ) peptide chain release factor 1
  • ( TIGR00962 ) ATP synthase F1, alpha subunit
  • ( TIGR03324 ) alternate F1F0 ATPase, F1 subunit
  • ( PF00254 ) peptidyl-prolyl cis-trans isomerase, FKBP-type
  • ( PF02874 ) ATP synthase alpha/beta family, beta-barrel
  • ( PF00160 ) peptidyl-prolyl cis-trans isomerase, cyclophilin-type
  • ( PF00006 ) ATP synthase alpha/beta family, nucleotide-binding
  • ( TIGR02552 ) type III secretion low calcium

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00548130

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17056.19.997093137033517e-262hypothetical protein (469 aa)
OxytrichaContig19730.0.g301.999149254372995e-126Cyclophilin type peptidyl-prol
yl cis-trans isomerase/CLD
WormBaseWBGene000008833.001032840497736e-70locus:cyn-7 Peptidyl-prolyl
cis-trans isomerase 7 status
:Confirmed UniProt:P52015
protein_id:CAA21760.1
Stentor CoeruleusSteCoe_57708.854771883513433e-70
DictyBaseDDB_G02823599.997863464222902e-69ppiA on chromosome: 3 position
5684660 to 5685426
SGDYLR216C7.00308173940364e-57CPR6 Peptidyl-prolyl cis-trans
isomerase (cyclophilin), cata
lyzes the cis-trans isomerizat
ion of peptide bonds N-termina
l to proline residues; binds t
o Hsp82p and contributes to ch
aperone activity

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00548130(coding)
ATGACTTAAGAAATTATTAACATTACAGAAGACGGTGGTATCACCAAGCAAATTCTTCAA
TAAGGTGAAGGAGACGAATATCCATAAGCTGGTTAGACTGTTGAAGTTTTATACACTGGA
AAACTTCTTGATGGAACAGAATTTGATTCAAATACTAATAGAGATGATCCTTTTTCTTTC
ACAATTGGCAAAGGTTAGGTTATCAAAGGATGGGATTTAGGTGTTGCTACAATGAAGAGA
GGTGAAAAGGCTGTCCTTACCTGCACAGCTCCTAATGCCTATGGTGAAACTGGAAGTCCC
CCTAGAATTCCTCCTAATGCTACTTTACAATTTGAAGTTGAATTGATTGACTTCCGCGAG
AGAACTAAAACAAAATGGGATTACTCATTAGAAGAAAGAGTTGAAATTGCCAAAAAATAC
AAAGATGAGGGTAATGACGCTTTCAAAAAAGGTGATCTTGAAGAAGCTGATGTTTTATAC
GATTAATGTATTGATTACGTTGATTTTGGTGAAGATGTTAATGGTTCTCTTGAACTTAAG
TTCACTGCTTACCTTAACCAAGCAACAGTTTATAATAAATAAAAAAAATGGGACAAAGCT
ATTAAGAATTGCACTATTGTTATTGAAAAGCAACCTAATAACATCAAGGCTTACTTCAGA
AGAGGTACTGCTAGAATGAATTATGGTTTCTTAGATGAGGCTAAAGCTGATTTCCATAAA
GCACAAGAATTAGATCCTAACAATGCTGAAGTTATCAATTCTTTGAAAGTTCTTGCTTAG
AAGTAAAAAGAAGCCAATGAAAAGCAAAAGAAAATGTGGGGTGGCCTTTTTAAAAATTCA
TATTATGACGACTAAAAATAAACTATTGTAGAATTCTCTGATCCTAGTAATCCTGTTGTT
TTCTTTGATATTCAAATCGGAGAAGAAGAACCTTAGAGAGTTGAATTTGAGCTTTTCAAG
AATATTGCTCCTAAAACTGCTGAAAATTTCCGTGCCCTTTGCACTGGAGAAAAAGGTACT
GGCGTTTCAGGAAAGCCTCTTCATTATAAGGGATCCATATTCCACCGTCTTATTAAAGAT
TTTATGATTTAGGGAGGTGATTTCACTAACTCTAACGGTACTGGAGGTGAATCAATTTAT
GGCGCCAAATTCCCTGACGAAGACTTCAAAGCAAAGCATACTAAGAGAGGTTTACTCTCT
ATGGCTAACAGTGGTCCTAACACAAACGGAAGTTAGTTCTTTATCACCTTTAAAAAAACA
GAATGGCTCGATGGTAAGCACGTAGTTTTTGGTGCTGTAACTAAAAATATCGAATTCCTT
GATAAACTTGAAAACTCTCCTTGCGAAGGCGAAAACCCATCTCCAAGCATTAAAGTTGTT
GACTGTGGTGTCGTTAAAGCTTGA


>TTHERM_00548130(protein)
MTQEIINITEDGGITKQILQQGEGDEYPQAGQTVEVLYTGKLLDGTEFDSNTNRDDPFSF
TIGKGQVIKGWDLGVATMKRGEKAVLTCTAPNAYGETGSPPRIPPNATLQFEVELIDFRE
RTKTKWDYSLEERVEIAKKYKDEGNDAFKKGDLEEADVLYDQCIDYVDFGEDVNGSLELK
FTAYLNQATVYNKQKKWDKAIKNCTIVIEKQPNNIKAYFRRGTARMNYGFLDEAKADFHK
AQELDPNNAEVINSLKVLAQKQKEANEKQKKMWGGLFKNSYYDDQKQTIVEFSDPSNPVV
FFDIQIGEEEPQRVEFELFKNIAPKTAENFRALCTGEKGTGVSGKPLHYKGSIFHRLIKD
FMIQGGDFTNSNGTGGESIYGAKFPDEDFKAKHTKRGLLSMANSGPNTNGSQFFITFKKT
EWLDGKHVVFGAVTKNIEFLDKLENSPCEGENPSPSIKVVDCGVVKA


>TTHERM_00548130(gene)
ATGACTTAAGAAATTATTAACATTACAGAAGACGGTGGTATCACCAAGCAAATTCTTCAA
TAAGGTGAAGGAGACGAATATCCATAAGCTGGTTAGACTGTTGAAGGTAAATAAATCAAT
TTAATTTAAAGAAGAACTTACTTGTTAGTCACTTTCAATCAACACTCAAATCAAAGAAAG
GCATCGTTTTCTAATTAATTTCAAATTTTAAAAAAACAGTTTTATACACTGGAAAACTTC
TTGATGGAACAGAATTTGATTCAAATACTAATAGAGATGATCCTTTTTCTTTCACAATTG
GCAAAGGTTAGGTTATCAAAGGATGGGATTTAGGTAATATTCAAGAATTTGATTCTTAAA
ATCAGAGTCTGCAATAAAATTTATTTAACAAAAAGGTGTTGCTACAATGAAGAGAGGTGA
AAAGGCTGTCCTTACCTGCACAGCTCCTAATGCCTATGGTGAAACTGGAAGTCCCCCTAG
AATTCCTCCTAATGCTACTTTACAATTTGAAGTTGAATTGATTGACTTCCGCGAGAGAAC
TAAAACAAAATGGGATTACTCATTAGAAGAAAGAGTTGAAATTGCCAAAAAATACAAAGA
TGAGGGTAATGACGCTTTCAAAAAAGGTGATCTTGAAGAAGCTGATGTTTTATACGATTA
ATGTATTGATTACGTTGATTTTGGTGAAGATGTTAATGGTTCTCTTGAACTTAAGTTCAC
TGCTTACCTTAACCAAGCAACAGTAAGAATAATTAAATTTACTTTTTAGAAAACAAAAAT
TTAAAAACAGCTGCAAAAAATAAATCAGCAACAATAGAATTATTTTATTTTTAATTAAAT
AGGTTTATAATAAATAAAAAAAATGGGACAAAGCTATTAAGAATTGCACTATTGTTATTG
AAAAGCAACCTAATAACATCAAGGCTTACTTCAGAAGAGGTACTGCTAGAATGAATTATG
GTTTCTTAGATGAGGCTAAAGCTGATTTCCATAAAGCACAAGAATTAGATCCTAACAATG
CTGAAGTTATCAATTCTTTGAAAGTTCTTGCTTAGAAGTAAAAAGAAGCCAATGAAAAGC
AAAAGAAAATGTGGGGTGGCCTTTTTAAAAATTCATATTATGACGACTAAAAATAAACTA
TTGTAGAATTCTCTGATCCTAGTAATCCTGTTGTTTTCTTTGATATTCAAATCGGAGAAG
AAGAACCTTAGAGAGTTGAATTTGAGCTTTTCAAGAATATTGCTCCTAAAACTGCTGAAA
ATTTCCGTGCCCTTTGCACTGGAGAAAAAGGTACTGGCGTTTCAGGAAAGCCTCTTCATT
ATAAGGGATCCATATTCCACCGTCTTATTAAAGATTTTATGATTTAGGGAGGTGATTTCA
CTAACTCTAACGGTACTGGAGGTGAATCAATTTATGGCGCCAAATTCCCTGACGAAGACT
TCAAAGCAAAGCATACTAAGAGAGGTTTACTCTCTATGGCTAACAGTGGTCCTAACACAA
ACGGAAGTTAGTTCTTTATCACCTTTAAAAAAACAGAATGGCTCGATGGTAAGCACGTAG
TTTTTGGTGCTGTAACTAAAAATATCGAATTCCTTGATAAACTTGAAAACTCTCCTTGCG
AAGGCGAAAACCCATCTCCAAGCATTAAAGTTGTTGACTGTGGTGTCGTTAAAGCTTGA