Identifiers and Description

Gene Model Identifier

TTHERM_00128770

Standard Name

PPI19 (peptidylprolyl isomerase 19)

Aliases

PreTt09441 | 9.m00462 | 3699.m00170

Description

TPR Domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00515 ) tetratricopeptide repeat
  • ( PF07719 ) tetratricopeptide repeat
  • ( PF00254 ) peptidyl-prolyl cis-trans isomerase, FKBP-type

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.7%

TetraMine Data

TTHERM_00128770

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09190.13.998345761652816e-169TPR Domain containing protein
(275 aa)
DictyBaseDDB_G02858270.000000000000020000882446601127DDB_G0285827 on chromosome: 4
position 3706474 to 3707930
OxytrichaContig19730.0.g300.0000000000005000841553255702Cyclophilin type peptidyl-prol
yl cis-trans isomerase/CLD
Stentor CoeruleusSteCoe_57700.00000000003775134544279098
WormBaseWBGene000169660.00000000006996681903814525status:Confirmed UniProt:Q18
888 protein_id:CCD68181.1
SGDYGR123C0.00000000009998509410508463PPT1 Protein serine/threonine
phosphatase with similarity to
human phosphatase PP5; presen
t in both the nucleus and cyto
plasm; expressed during logari
thmic growth; computational an
alyses suggest roles in phosph
ate metabolism and rRNA proces
sing

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00128770(coding)
ATGACTGCTTTTACTAACGTTGATGAAAAAGGTTTACTTTAAAAGTAGATTATTAAGGAT
GGAATTGGAGATTGCCCAGAAAAATACAGAGAAGTTTATGTTTATTTTGTTCTCAGAAAT
GAAAGAGGTGATTTAATCACTGGTACAGAATCACAACCCTACAAAGTAGTCATGGGACGT
GGAGATTCATTCTAGTTTATGGAATAACTTCTTTTGACTATGAAATTAGGAGAAAGAATT
TTAGCAAAAATTGATAAATAGCTAGTAAAGGATGATAAAAAGTTATCTAAATTAGTGAAC
AATGAAGAAATGAATTTAGAATTAGAAATAGAAATCGTAAGATTAATGAACTACAGAAAC
AGTTTATGGGAATTGGAAAGCGATGACAGAGAAGCCTTAGTTCAAACAATTAAAAACTAA
GGAAATGAATTTATCAAAAACAAAGAATATTAAAATGCTACATACAAGTATGAGTCAGGA
TTAAAAACAATAAAAAATGATTAAAATTCTGTTTTCGATGAAGTCTAATAGTCTTTACTA
AATAACTTATCTTTAGCATATCTTAAAAATAATCAATTTGCTGAATGTATTGAAACTGCC
ACTGAAGCCCTTAAAAGCTAGCCCTCAAATGTTAAACTTTTATACAGAAGAGCATAAGCC
TATTCTGGCACTCAAGAATACGAAAAAGCTAAGTCAGATTTGAAAGAAGGTTTGAAGCTT
GATCCTAATAATGCTGAGTTGCAAAAAGAATTAAACGCTTTAATTAACAAGGAAAAGATT
TAAATTGAAAAAGAAAAAAAAGTCTATGCTAACATGTTTAAATGA


>TTHERM_00128770(protein)
MTAFTNVDEKGLLQKQIIKDGIGDCPEKYREVYVYFVLRNERGDLITGTESQPYKVVMGR
GDSFQFMEQLLLTMKLGERILAKIDKQLVKDDKKLSKLVNNEEMNLELEIEIVRLMNYRN
SLWELESDDREALVQTIKNQGNEFIKNKEYQNATYKYESGLKTIKNDQNSVFDEVQQSLL
NNLSLAYLKNNQFAECIETATEALKSQPSNVKLLYRRAQAYSGTQEYEKAKSDLKEGLKL
DPNNAELQKELNALINKEKIQIEKEKKVYANMFK


>TTHERM_00128770(gene)
ATGACTGCTTTTACTAACGTTGATGAAAAAGGTTTACTTTAAAAGTAGATTATTAAGGAT
GGAATTGGAGATTGCCCAGAAAAATACAGAGAAGTTTATGGTAAATAAATTTAATTTATA
AATACTTAATTCTAAAATATTTTTTTATTTTGAAGTTTATTTTGTTCTCAGAAATGAAAG
AGGTGATTTAATCACTGGTACAGAATCACAACCCTACAAAGTAGTCATGGGACGTGGAGA
TTCATTCTAGTTTATGGAATAACTTCTTTTGACTATGAAATTAGGAGAAAGAATTTTAGC
AAAAATTGATAAATAGCTAGTAAAGGATGATAAAAAGTTATCTAAATTAGTGAACAATGA
AGAAATGAATTTAGAATTAGAAATAGAAATCGTAAGATTAATGAACTACAGAAACAGTTT
ATGGGAATTGGAAAGCGATGACAGAGAAGCCTTAGTTCAAACAATTAAAAACTAAGGAAA
TGAATTTATCAAAAACAAAGAATATTAAAATGCTACATACAAGTATGAGTCAGGATTAAA
AACAATAAAAAATGATTAAAATTCTGTTTTCGATGAAGTCTAATAGTCTTTACTAAATAA
CTTATCTTTAGCATATCTTAAAAATAATCAATTTGCTGAATGTATTGAAACTGCCACTGA
AGCCCTTAAAAGCTAGCCCTCAAATGTTAAACTTTTATACAGAAGAGCATAAGCCTATTC
TGGCACTCAAGAATACGAAAAAGCTAAGTCAGATTTGAAAGAAGGTTTGAAGCTTGATCC
TAATAATGCTGAGTTGCAAAAAGAATTAAACGCTTTAATTAACAAGGAAAAGATTTAAAT
TGAAAAAGAAAAAAAAGTCTATGCTAACATGTTTAAATGA