Identifiers and Description

Gene Model Identifier

TTHERM_00681780

Standard Name

PPI18 (peptidylprolyl isomerase 18)

Aliases

PreTt16115 | 103.m00106 | 3734.m00019

Description

peptidyl-prolyl cis-trans isomerase, FKBP-type family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF08946 ) Osmosensory transporter coiled coil
  • ( PF00254 ) peptidyl-prolyl cis-trans isomerase, FKBP-type

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00681780

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14720.16.998750589667296e-179peptidyl-prolyl cis-trans isom
erase, FKBP-type family protei
n (370 aa)
SGDYNL135C0.00000000019994075865167896FPR1 Peptidyl-prolyl cis-trans
isomerase (PPIase), binds to
the drugs FK506 and rapamycin;
also binds to the nonhistone
chromatin binding protein Hmo1
p and may regulate its assembl
y or function
WormBaseWBGene000014270.00000000030007160092483236locus:fkb-2 Peptidyl-prolyl
cis-trans isomerase status:C
onfirmed UniProt:Q9U2Q8 pr
otein_id:CAA22330.1
OxytrichaContig9028.0.g20.00000005001214305021125FKBP-type peptidyl-prolyl cis-
trans isomerase
DictyBaseDDB_G02822670.00003998524687536623DDB_G0282267 on chromosome: 3
position 5592466 to 5593048

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00681780(coding)
ATGAGTAGTTCAAAAAAATTCTAATTTTTTAATGAGTAAGAATAGCAGCCTATGAGATGC
TAAATACATAAAAATTCAAATCTTAATTAAATATGTGTTTAAGATGGCTGCATTTTATAA
TTTTAGCCAAATTGTCCTCTTTGTTAATATGATAAATAGAATACATGCAATTAGCATTAT
GTTATGCCAATTCAAGCATTTTTTTGCTAATTAGAAAGCTTAGTATAGGAAGAAGTTATT
TTAAATCCTACAAACTATGTTTGCTCAGATGAAATAAGTTTACTTGCAAGACAATTTAAA
AATTTAGGAAACAAATGTTTAGAAATATCAGAAAATATAGCCATGTCAACTTCTAAACAC
AAAAAAACATTTGTAAACCTTGCTCCTGAAATAAAAGCTGTAGAAAATATAATTAAAAAT
GTTAAATAAGATGATTGCACTTAAAATATTAGATTAAATTTGATGCAATTAAGTTAATAT
ATATAAATATAACCAGATGGTAATCTTTCTTTTTAGTTCAGAAATAATGAAAAGCTCGAT
AGACTTTAACTAAGATATTACTAATATTATTCAAAACTAGAGTAGTTATATTCTTATATA
ATAAATGATTTAAATACAGCTCATTAAAATTCTATTTTTTACACAGGTGTACAGTTTGGT
AGTAATCCTTCTAGTGATAAGAAATCTGATTACTCAACGAATAGCAGTTGTATTGATTAG
TAAATTGAAAGGATGAGAGCTGTTTTAGAAAGCCCACAAAAGGTTGGAATGAAGTTAAGT
AATGAGAGCTACTTCAAAGTGAAAATAATGGAAAAGGGGGATTAAAAAACTTTCCCTTTA
TACAAATAAAAAGTAAAAATTAATTACAAAATTTATGATGAGGATTTCAACTTGCTTGAT
CAAAACAAAGAAGGTAACCCTTTTATATTTACAATTGGTATTGGAGAAGTCATTAAAGGT
TGGGAACTGGCTATTCCTGAAATGAGTTTAGGAGAAAAATCTTTGATTATATGCCATAAA
AATTTGATAAATAACTCAAAATATAATAATATCCTTTAAAATTAACAATCATCTTAGTCT
TTGTATTTTGAAATACAAATTGTTGATATAATATGA


>TTHERM_00681780(protein)
MSSSKKFQFFNEQEQQPMRCQIHKNSNLNQICVQDGCILQFQPNCPLCQYDKQNTCNQHY
VMPIQAFFCQLESLVQEEVILNPTNYVCSDEISLLARQFKNLGNKCLEISENIAMSTSKH
KKTFVNLAPEIKAVENIIKNVKQDDCTQNIRLNLMQLSQYIQIQPDGNLSFQFRNNEKLD
RLQLRYYQYYSKLEQLYSYIINDLNTAHQNSIFYTGVQFGSNPSSDKKSDYSTNSSCIDQ
QIERMRAVLESPQKVGMKLSNESYFKVKIMEKGDQKTFPLYKQKVKINYKIYDEDFNLLD
QNKEGNPFIFTIGIGEVIKGWELAIPEMSLGEKSLIICHKNLINNSKYNNILQNQQSSQS
LYFEIQIVDII


>TTHERM_00681780(gene)
ATGAGTAGTTCAAAAAAATTCTAATTTTTTAATGAGTAAGAATAGCAGCCTATGAGATGC
TAAATACATAAAAATTCAAATCTTAATTAAATATGTGTTTAAGATGGCTGCATTTTATAA
TTTTAGCCAAATTGTCCTCTTTGTTAATATGATAAATAGAATACATGCAATTAGCATTAT
GTTATGCCAATTCAAGCATTTTTTTGCTAATTAGAAAGCTTAGTATAGGAAGAAGTTATT
TTAAATCCTACAAACTATGTTTGCTCAGATGAAATAAGTTTACTTGCAAGACAATTTAAA
AATTTAGGAAACAAATGTTTAGAAATATCAGAAAATATAGCCATGTCAACTTCTAAACAC
AAAAAAACATTTGTAAACCTTGCTCCTGAAATAAAAGCTGTAGAAAATATAATTAAAAAT
GTTAAATAAGATGATTGCACTTAAAATATTAGATTAAATTTGATGCAATTAAGTTAATAT
ATATAAATATAACCAGATGGTAATCTTTCTTTTTAGTTCAGAAATAATGAAAAGCTCGAT
AGACTTTAACTAAGATATTACTAATATTATTCAAAACTAGAGTAGTTATATTCTTATATA
ATAAATGATTTAAATACAGCTCATTAAAATTCTATTTTTTACACAGGTGTACAGTTTGGT
AGTAGTAAATAATTACTTATTAATATATTTTTTTAATTATTTTAGCTTGAATTTAAAAAT
CTTTTTACTTAAAATTTTAAGGGCTTCTAAAAATTTAAATAAATATTTCATTATCAAAAT
AGATCCTTCTAGTGATAAGAAATCTGATTACTCAACGAATAGCAGTTGTATTGATTAGTA
AATTGAAAGTAAACAAATATGCTAATTGTATAAAATGAGAAGTTAAATATTTTAAAATAA
TGTTTAGGGATGAGAGCTGTTTTAGAAAGCCCACAAAAGGTTGGAATGAAGTTAAGTAAT
GAGAGCTACTTCAAAGTGAAAATAATGGAAAAGGGGGATTAAAAAACTTTCCCTTTATAC
AAATAAAAAGTAAAAATTAATTACAAAATTTATGATGAGGATTTCAACTTGCTTGATCAA
AACAAAGAAGGTAACCCTTTTATATTTACAATTGGTATTGGAGAAGTCATTAAAGGTTGG
GAACTGGCTATTCCTGAAATGAGTTTAGGAGAAAAATCTTTGATTATATGCCATAAAAAT
TTGATAAATAACTCAAAATATAATAATATCCTTTAAAATTAACAATCATCTTAGTCTTTG
TATTTTGAAATACAAATTGTTGATATAATATGA