Identifiers and Description

Gene Model Identifier

TTHERM_00865350

Standard Name

PPI16 (peptidylprolyl isomerase 16)

Aliases

PreTt29165 | 154.m00123 | 3751.m00469

Description

peptidyl-prolyl cis-trans isomerase, cyclophilin-type family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00865350

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19698.11.0003602942354155e-110peptidyl-prolyl cis-trans isom
erase, cyclophilin-type family
protein (167 aa)
SGDYDR155C5.000518477595783e-71CPR1 Cytoplasmic peptidyl-prol
yl cis-trans isomerase (cyclop
hilin), catalyzes the cis-tran
s isomerization of peptide bon
ds N-terminal to proline resid
ues; binds the drug cyclospori
n A
WormBaseWBGene000008833.999627495270728e-67locus:cyn-7 Peptidyl-prolyl
cis-trans isomerase 7 status
:Confirmed UniProt:P52015
protein_id:CAA21760.1
OxytrichaContig20635.0.g1138.003355238965419e-63Cyclophilin type peptidyl-prol
yl cis-trans isomerase/CLD
DictyBaseDDB_G02691205.997098480211051e-62cypB on chromosome: 1 position
3371521 to 3372496
Stentor CoeruleusSteCoe_243153.221340285992516e-27

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00865350(coding)
ATGTCTAAATTCCCTAATGTATACTTTGATGTAGTTATAGGAACTGCAGAACCAAAAAGA
ATAGTTTTTAAACTTTATGATGATGTTCCATTGACAGCTGAAAATTTTAGAGCCTTGTGC
ACTGGAGAAAAGGGCTTTGGATATCAAGGATGTCCTTTCCACAGAATTATTCCCGAATTT
ATGATTTAAGGAGGAGATTTTACAAACAGAAACGGAACTGGTGGAAAATCAATTTATGGC
GAGACCTTTGCTGATGAAAACTTCAATCATAAACATGTAAAAAAAGGACTTTTATCCATG
GCAAATGCAGGACCAGGCACTAACGGCTCATAGTTCTTTATCACAACAGTTCCCTGCCCT
TGGTTGGATAATAAGCATGTAGTATTTGGTGAAGTTATTGAAGGCTTGGATGTTGTTGAT
GAATTAGAGGAAACAGGAACCTCTATGGGAAGACCTAAAGGTGGAAAATAATCTTATATC
AAATCATGCGGTTAACTTTGA


>TTHERM_00865350(protein)
MSKFPNVYFDVVIGTAEPKRIVFKLYDDVPLTAENFRALCTGEKGFGYQGCPFHRIIPEF
MIQGGDFTNRNGTGGKSIYGETFADENFNHKHVKKGLLSMANAGPGTNGSQFFITTVPCP
WLDNKHVVFGEVIEGLDVVDELEETGTSMGRPKGGKQSYIKSCGQL


>TTHERM_00865350(gene)
ATGTCTAAATTCCCTAATGTATACTTTGATGTAGTTATAGGAACTGCAGAACCAAAAAGA
ATAGTTTTTAAACTTTATGATGATGTTCCATTGACAGCTGAAAATTTTAGAGCCTTGTGC
ACTGGAGAAAAGGGCTTTGGATATCAAGGATGTCCTTTCCACAGAATTATTCCCGAATTT
ATGATTTAAGGAGGAGATTTTACAAACAGAAACGGAACTGGTGGAAAATCAATTTATGGC
GAGACCTTTGCTGATGAAAACTTCAATCATAAACATGTAAAAAAAGGACTTTTATCCATG
GCAAATGCAGGACCAGGCACTAACGGCTCATAGTTCTTTATCACAACAGTTCCCTGCCCT
TGGTTGGATAATAAGCATGTAGTATTTGGTGAAGTTATTGAAGGCTTGGATGTTGTTGAT
GAATTAGAGGAAACAGGAACCTCTATGGGAAGACCTAAAGGTGGAAAATAATCTTATATC
AAATCATGCGGTTAACTTTGA