Identifiers and Description

Gene Model Identifier

TTHERM_00118710

Standard Name

PPI15 (peptidylprolyl isomerase 15)

Aliases

PreTt27187 | 8.m00447 | 3812.m02480

Description

peptidyl-prolyl cis-trans isomerase, cyclophilin-type family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00118710

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03866.11.9998521972819316e-89peptidyl-prolyl cis-trans isom
erase, cyclophilin-type family
protein (163 aa)
SGDYML078W4.997699094967085e-82CPR3 Mitochondrial peptidyl-pr
olyl cis-trans isomerase (cycl
ophilin), catalyzes the cis-tr
ans isomerization of peptide b
onds N-terminal to proline res
idues; involved in protein ref
olding after import into mitoc
hondria
WormBaseWBGene000008831.0002223712504345e-79locus:cyn-7 Peptidyl-prolyl
cis-trans isomerase 7 status
:Confirmed UniProt:P52015
protein_id:CAA21760.1
DictyBaseDDB_G02823596.998611614275136e-73ppiA on chromosome: 3 position
5684660 to 5685426
OxytrichaContig20635.0.g1131.99927841627239e-68Cyclophilin type peptidyl-prol
yl cis-trans isomerase/CLD
Stentor CoeruleusSteCoe_277461.462486227251231e-31

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00118710(coding)
ATGGCTAACCCTAGAGTTTACTTTGACATCAGTATCGGTGGTTAAAACGCTGGCAGAATC
GAATTCGAATTATTTTCTAATGTCCCCAAGACTGCTGAAAACTTCAGAGCTTTATGCACT
GGTGAAAAGGGTTTCGGTTACAAGGGATGTCCTTTCCATAGAATCATTCCTTAATTCATG
ATCTAAGGTGGTGATTTCACTAAGCAAAACGGAACTGGTGGTAAATCTATCTACGGTGAA
AAGTTTGCTGATGAAAACTTCATTTACAAGCACACTGAACCTGGTATGTTATCCATGGCT
AATGCTGGTCCTAACACTAACGGTTCCTAATTCTTCATCACCACCGTTCCTTGCCCCTGG
TTAGACGGTAAGCACGTTGTCTTTGGTAAGGTCACCAAGGGTTTAGATATCGTTAAAAAG
TTAGAAGGCCAAGGTACTTCAACCGGAAAAACTAAAGTTGCATGTGCTATCTTAGATTGC
GGTCAACTCTGA


>TTHERM_00118710(protein)
MANPRVYFDISIGGQNAGRIEFELFSNVPKTAENFRALCTGEKGFGYKGCPFHRIIPQFM
IQGGDFTKQNGTGGKSIYGEKFADENFIYKHTEPGMLSMANAGPNTNGSQFFITTVPCPW
LDGKHVVFGKVTKGLDIVKKLEGQGTSTGKTKVACAILDCGQL


>TTHERM_00118710(gene)
ATGGCTAACCCTAGAGTTTACTTTGACATCAGTATCGGTGGTTAAAACGCTGGCAGAATC
GAATTCGAATTATTTTCTAATGTCCCCAAGACTGCTGAAAACTTCAGAGCTTTATGCACT
GGTGAAAAGGGTTTCGGTTACAAGGGATGTCCTTTCCATAGAATCATTCCTTAATTCATG
ATCTAAGGTGGTGATTTCACTAAGCAAAACGGAACTGGTGGTAAATCTATCTACGGTGAA
AAGTTTGCTGATGAAAACTTCATTTACAAGCACACTGAACCTGGTATGTTATCCATGGCT
AATGCTGGTCCTAACACTAACGGTTCCTAATTCTTCATCACCACCGTTCCTTGCCCCTGG
TTAGACGGTAAGCACGTTGTCTTTGGTAAGGTCACCAAGGGTTTAGATATCGTTAAAAAG
TTAGAAGGCCAAGGTACTTCAACCGGAAAAACTAAAGTTGCATGTGCTATCTTAGATTGC
GGTCAACTCTGA