Identifiers and Description

Gene Model Identifier

TTHERM_00890120

Standard Name

PPI14 (peptidylprolyl isomerase 14)

Aliases

PreTt23324 | 158.m00080

Description

peptidyl-prolyl cis-trans isomerase, cyclophilin-type family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00160 ) peptidyl-prolyl cis-trans isomerase, cyclophilin-type

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00890120

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15772.11.999064828370117e-102peptidyl-prolyl cis-trans isom
erase, cyclophilin-type family
protein (174 aa)
SGDYML078W2.0002571866765887e-62CPR3 Mitochondrial peptidyl-pr
olyl cis-trans isomerase (cycl
ophilin), catalyzes the cis-tr
ans isomerization of peptide b
onds N-terminal to proline res
idues; involved in protein ref
olding after import into mitoc
hondria
DictyBaseDDB_G02691201.999576471039937e-58cypB on chromosome: 1 position
3371521 to 3372496
WormBaseWBGene000008793.998564387823535e-58locus:cyn-3 Peptidyl-prolyl
cis-trans isomerase 3 status
:Confirmed UniProt:P52011
protein_id:CAA21762.1
OxytrichaContig5638.0.g561.0001801308941382e-55Cyclophilin type peptidyl-prol
yl cis-trans isomerase/CLD
Stentor CoeruleusSteCoe_183656.47023492564546e-26

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00890120(coding)
ATGTGTTTTGGTGAGAAAACCTATCCTAATTGTTTTTTTGAGATAGAAATAGATGGAAAA
TAAGTTGGTATGATCACTTTTAAATTATATGATAAAGTGACACCTAAGACAGCAAGAAAT
TTCAGAGAGCTTTGCACTGGTTAGAATGGATTTGGTTATAAAGGGATACCATTTCATAGA
ATATCTAAAAATTTTGTAATTTAAGGAGGAGATATAACTAATAGAGATGGATCTGGAGGC
AAATCTATTTACGGGCAGAGTTTTAAGGATGAAAATTTCAAGCTAACCCATAACAAGCCA
GGAATTCTTTCCATGGCAAATTATGGGCCAAATACAAATGGTTCATAATTCTTCATTACA
CTAAATGCTTGTGAAGGATTAGACAAATTGCATGTAGTTTTTGGCGAAGTTGTTTAAGGT
ATGGACGTTGTTAAAGAAATAGAAAAGGTAGAAACTTATGGAGAAAAGCCAATGGTAAGA
TGTGTTATAAAAAACTGTGGAGTTGTATAAGAAGATTGA


>TTHERM_00890120(protein)
MCFGEKTYPNCFFEIEIDGKQVGMITFKLYDKVTPKTARNFRELCTGQNGFGYKGIPFHR
ISKNFVIQGGDITNRDGSGGKSIYGQSFKDENFKLTHNKPGILSMANYGPNTNGSQFFIT
LNACEGLDKLHVVFGEVVQGMDVVKEIEKVETYGEKPMVRCVIKNCGVVQED


>TTHERM_00890120(gene)
ATGTGTTTTGGTGAGAAAACCTATCCTAATTGTTTTTTTGAGATAGAAATAGATGGAAAA
TAAGTTGGTATGATCACTTTTAAATTATATGATAAAGTGACACCTAAGACAGCAAGAAAT
TTCAGAGAGCTTTGCACTGGTTAGAATGGATTTGGTTATAAAGGGATACCATTTCATAGA
ATATCTAAAAATTTTGTAATTTAAGGAGGAGATATAACTAATAGAGATGGATCTGGAGGC
AAATCTATTTACGGGCAGAGTTTTAAGGATGAAAATTTCAAGCTAACCCATAACAAGCCA
GGAATTCTTTCCATGGCAAATTATGGGCCAAATACAAATGGTTCATAATTCTTCATTACA
CTAAATGCTTGTGAAGGATTAGACAAATTGCATGTAGTTTTTGGCGAAGTTGTTTAAGGT
ATGGACGTTGTTAAAGAAATAGAAAAGGTAGAAACTTATGGAGAAAAGCCAATGGTAAGA
TGTGTTATAAAAAACTGTGGAGTTGTATAAGAAGATTGA