Identifiers and Description

Gene Model Identifier

TTHERM_00772040

Standard Name

PPI13 (peptidylprolyl isomerase 13)

Aliases

PreTt13943 | 127.m00106

Description

peptidyl-prolyl cis-trans isomerase, cyclophilin-type family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF04564 ) U-box domain
  • ( TIGR00192 ) urease, beta subunit
  • ( PF04641 ) Protein of unknown function, DUF602
  • ( PF00160 ) peptidyl-prolyl cis-trans isomerase, cyclophilin-type

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00772040

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05669.19.997093137033517e-262peptidyl-prolyl cis-trans isom
erase, cyclophilin-type family
protein (555 aa)
OxytrichaContig19826.0.g539.996472444528484e-132Cyclophilin type peptidyl-prol
yl cis-trans isomerase/CLD
WormBaseWBGene000008807.0000984021781654e-99locus:cyn-4 Peptidyl-prolyl
cis-trans isomerase 4 status
:Confirmed UniProt:P52012
protein_id:CAA85417.1
DictyBaseDDB_G02692166.00092892288903e-46cypE on chromosome: 1 position
3461467 to 3462395
SGDYML078W2.00017271388466e-38CPR3 Mitochondrial peptidyl-pr
olyl cis-trans isomerase (cycl
ophilin), catalyzes the cis-tr
ans isomerization of peptide b
onds N-terminal to proline res
idues; involved in protein ref
olding after import into mitoc
hondria
Stentor CoeruleusSteCoe_277462.3195228302435696e-16

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00772040(coding)
ATGGGAAAACATAGACACACTAAAGATCGTATGTTTATTTCATACACCGAGCATAAAATG
GAATGGGGTGGTAAAAAAGATCCAGAAAAAGTTCCTATGAGTAAATTACCATTTTTTTGC
TGTAGTTTGAGCTTAACTCCTTTTAAAAATCCTGTATGTTCTCCAGATGGAATTGTATTT
GATATTATGAGCATCATTCCTTACATAAAAAAGTATAAAAAAAATCCAGTCACAGGCGAG
GATTTAAAAATTAGCGATTTAATTACTTTGAAATTTTCTAAAAATGATAATGGTGAATAT
TAAGATCCAATTTCTTTTAAAGTATTCACTGACCATACTCACATTGTAACAATTAAGACT
TCAGGCAATGTATACAGCTTCGATACAGTTGATAAACTTAACAGAGAAGCAAAGTATTGG
TAAGATTTAATGACTGGAGAAAAATTCACACCAAAAGACATCATAACTTTGAATGATCCT
AAAAATTTAGAAAATAGAACTATCAAAAATTTTGATTATATAAGAAATAATATTGAAGTT
GAATTGAAAGATAAAGGAAATGATGCCTTTATCAATAAGAATGAAGCTACAAAAAATATT
CTTACCAAATATTAAGAAAAACAAAAGTAAGAAAATCTTGAACAGAAAAAGAAAGACGAT
GAAGAAATAGAATAAATTAGGAAATAGAGAAAGGAAGAATTAGAGAAACTTGAAAAAGGA
GAGCAAATTCCTGTTGCTGATTTTATAAAATCAGCTATTAGAAACAGAGATTTCATTCAT
TAGAGAGAAACTACTAGTGATGTTGCTGTCAGTGTTACAAGTACAGCCTCTGCAGTTATG
AGAGAATAAGGAAGTTTAGAATTCAGAAGTTTAAATGAAACAGAAATTAGAAAGATTATT
CATGATTAGGTCAAAAATAAATAAATGAAGGGCTATGTAAATATTATAACTAATATAGGA
GAAATATAATGCATGATTCATGCAAATTTTGTTCCTAAAACATCTGAAAATTTCCTCGAA
TTGTGTGAAAAAGGTTATTATAACGGAATTAAATTCCACAGATTAGTAAAGGACTTCATG
ATTCAAGGAGGAGATCCAACTGGTACTGGAAGAGGTGGCGAGTCAATTTTCGGATATAAA
TTTGAAGATGAATTCCATGCTAAAATTAGACATAGCAAGCCAGGTATTCTAAGTATGGCA
AATTCAGGGCCAAACACAAATGCATCTTAATTCTTTATAACTCTTGGAGAGTGTGCATGG
TTAGATGAGCAGCATAATGCTTTTGGTGAAGTAATTGGAAACCAATTAACCTTACATAAA
ATAAATACCCATCCAGTAAATGGAGAAAAACCAGCAACTCCAATAACTATTGAGAAAATC
ATAGTAGTTGAAAATCCTTTTAGATAAGTCATAGTCAAAATGTAGGAATAAAAAAGAGAA
AAGCTGAAAGAAGAAAAACGTAAAGCTTCAGAAAAAGAAAGAGAGCACGAGAGATGGATT
AGCAATGATGATAAATTTATTTTACCTAAACTTGCTGAAACTGAAGAAAAGCCTAAAATA
AAATCTGCTGGCTTAGCAAGCATGCTTACTGATCCTAAAAATTCAAATTATGATATACTA
CCAAAGGAAAAGCACAGAAAAAATTTTAATTTTTCTGACTGGTGA


>TTHERM_00772040(protein)
MGKHRHTKDRMFISYTEHKMEWGGKKDPEKVPMSKLPFFCCSLSLTPFKNPVCSPDGIVF
DIMSIIPYIKKYKKNPVTGEDLKISDLITLKFSKNDNGEYQDPISFKVFTDHTHIVTIKT
SGNVYSFDTVDKLNREAKYWQDLMTGEKFTPKDIITLNDPKNLENRTIKNFDYIRNNIEV
ELKDKGNDAFINKNEATKNILTKYQEKQKQENLEQKKKDDEEIEQIRKQRKEELEKLEKG
EQIPVADFIKSAIRNRDFIHQRETTSDVAVSVTSTASAVMREQGSLEFRSLNETEIRKII
HDQVKNKQMKGYVNIITNIGEIQCMIHANFVPKTSENFLELCEKGYYNGIKFHRLVKDFM
IQGGDPTGTGRGGESIFGYKFEDEFHAKIRHSKPGILSMANSGPNTNASQFFITLGECAW
LDEQHNAFGEVIGNQLTLHKINTHPVNGEKPATPITIEKIIVVENPFRQVIVKMQEQKRE
KLKEEKRKASEKEREHERWISNDDKFILPKLAETEEKPKIKSAGLASMLTDPKNSNYDIL
PKEKHRKNFNFSDW


>TTHERM_00772040(gene)
ATGGGAAAACATAGACACACTAAAGATCGTATGTTTATTTCATACACCGAGCATAAAATG
GGTAAATTAATAATGTTATTTTAATACTTTTTAACAGTTATTAAGTATGAATAAATTTAT
ATTTTGAAATATTTTTACTTATTAATAATAGAATGGGGTGGTAAAAAAGATCCAGAAAAA
GTTCCTATGAGTAAATTACCATTTTTTTGCTGTAGTTTGAGCTTAACTCCTTTTAAAAAT
CCTGTATGTTCTCCAGATGGAATTGTATTTGATATTATGTAAAATCTACTTGCTTTTTTA
TTATAATTACTTATTTTGATGAATAACTAAATATTAACTTATAATTTATAAAAAGGAGCA
TCATTCCTTACATAAAAAAGTATAAAAAAAATCCAGTCACAGGCGAGGATTTAAAAATTA
GCGATTTAATTACTTTGAAATTTTCTAAAAATGATAATGGTGAATATTAAGATCCAATTT
CTTTTAAAGTATTCACTGACCATACTCACATTGTAACAATTAAGACTTCAGGCAATGTAT
ACAGCTTCGATACAGTTGATAAACTTAACAGAGAAGCAAAGTATTGGTAAGATTTAATGA
CTGGAGAAAAATTCACACCAAAAGACATCATAACTTTGAATGATCCTAAAAATTTAGAAA
ATAGAACTATCAAAAATTTTGATTATATAAGAAATAATATTGAAGTTGAATTGAAAGATA
AAGGAAATGATGCCTTTATCAATAAGAATGAAGCTACAAAAAATATTCTTACCAAATATT
AAGAAAAACAAAAGGTATTTTAATATTTATAATAAATTAATTTTTGAGTTTATTTTAGAG
TTTCTTTAAAATTATATTAATAGTAAGAAAATCTTGAACAGAAAAAGAAAGACGATGAAG
AAATAGAATAAATTAGGAAATAGAGAAAGGAAGAATTAGAGAAACTTGAAAAAGGAGAGC
AAATTCCTGTTGCTGATTTTATAAAATCAGCTATTAGAAACAGAGATTTCATTCATTAGA
GAGAAACTACTAGTGATGTTGCTGTCAGTGTTACAAGTACAGCCTCTGCAGTTATGAGAG
AATAAGGAAGTTTAGAATTCAGAAGTTTAAATGAAACAGAAATTAGAAAGATTATTCATG
ATTAGGTCAAAAATAAATAAATGAAGGGCTATGTAAATATTATAACTAATATAGGAGAAA
TATAATGCATGATTCATGCAAATTTTGTTCCTAAAACATCTGAAAATTTCCTCGAATTGT
GTGAAAAAGGTTATTATAACGGAATTAAATTCCACAGATTAGTAAAGGACTTCATGGTAA
AATAGATTCACGTTTTAAATAATGATTGAAATAAACTTACCTTTATTATTAAAATAGATT
CAAGGAGGAGATCCAACTGGTACTGGAAGAGGTGGCGAGTCAATTTTCGGATATAAATTT
GAAGATGAATTCCATGCTAAAATTAGACATAGCAAGCCAGGTATTCTAAGTATGGCAAAT
TCAGGGCCAAACACAAATGCATCTTAATTGTAATTTAGATAGAATAATTTTTTGGTAGTG
TGAATTAACCTATTTTTTTAAAAAGCTTTATAACTCTTGGAGAGTGTGCATGGTTAGATG
AGCAGCATAATGCTTTTGGTGAAGTAATTGGAAACCAATTAACCTTACATAAAATAAATA
CCCATCCAGTAAATGGAGAAAAACCAGCAGTAAACAAAGTTATTTTGGAATAAATATTTA
ATTAATTTTTTAATAATAAAAAAGACTCCAATAACTATTGAGAAAATCATAGTAGTTGAA
AATCCTTTTAGATAAGTCATAGTCAAAATGTAGGAATAAAAAAGAGAAAAGCTGAAAGAA
GAAAAACGTAAAGCTTCAGAAAAAGAAAGAGAGCACGAGAGATGGATTAGCAATGATGAT
AAATTTATTTTACCTAAACTTGCTGAAACTGAAGAAAAGCCTAAAATAAAATCTGCTGGC
TTAGCAAGCATGCTTACTGATCCTAAAAATTCAAATTATGATATACTACCAAAGGAAAAG
CACAGAAAAAATTTTAATTTTTCTGACTGGTGA