Identifiers and Description

Gene Model Identifier

TTHERM_00075590

Standard Name

PPI11 (peptidylprolyl isomerase 11)

Aliases

PreTt10003 | 5.m00354 | 3828.m01266

Description

peptidyl-prolyl cis-trans isomerase, cyclophilin-type family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00400 ) WD domain, G-beta repeat
  • ( PF00160 ) peptidyl-prolyl cis-trans isomerase, cyclophilin-type

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00075590

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07153.19.997093137033517e-262peptidyl-prolyl cis-trans isom
erase, cyclophilin-type family
protein (638 aa)
DictyBaseDDB_G02690543.0009656946748407e-152ppwd1 on chromosome: 1 positio
n 1931476 to 1933597
OxytrichaContig10554.0.g229.99838497179609e-146Cyclophilin type peptidyl-prol
yl cis-trans isomerase/CLD
WormBaseWBGene000008915.0011520612761715e-143locus:cyn-15 status:Confirme
d UniProt:Q9U1Q3 protein_i
d:CAB60429.1
Stentor CoeruleusSteCoe_31181.4043787324419038e-54
SGDYML078W9.999888128184441e-42CPR3 Mitochondrial peptidyl-pr
olyl cis-trans isomerase (cycl
ophilin), catalyzes the cis-tr
ans isomerization of peptide b
onds N-terminal to proline res
idues; involved in protein ref
olding after import into mitoc
hondria

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00075590(coding)
ATGAGTGACAGCGAAGAAAGCAAAGTTTCTTAAAACGAAAAAAAATAATAGCTTATCAAA
TAAAATTAGTAAAGAAAATAAAACTTAGAAAGCGCAGATGTTGGTCCTTCTGTTAAGTTA
TTAAAAAATATTGATATTGTTGATGTGCTATTAAAAAATGTTCCAAGTGGAGAAATGTAT
GAAAAAAGTTACATGCATAGGGAGGTTGTTAATATGATTATAGGAGCTCCTAAAAACGAT
ACGATTATCACAATTAGTGTAGACGGACATGTCAAATTTTGGAGAAAAATTTATCAACTA
ATTGAACAAATCAAATACTTTAGATGTCATAAAGGTCCAGTAACAGGAGCATGTATTTCT
TTGAGTTAAGATTCTCTTATTACTGTTTGTGCTTCTGACTAAACCATGAAGAAATTCGAT
TTACTGAGCACTGATTTAAATAACTTTTAGAAATTCGATTTTAGACCTGCCACTTGCTAA
TTTGTTTAGTTAGATGACAGAGAAACAACATACTTATGTGTGAGTGATTTCGATAGTGGA
AAAATTAATGTTTATGATGATGTCAATGAAGAAAAATTAAATTTGGTAAAGACTCTTGAA
ATACATTCTAATTCAGTTAGGTTCTTGTTCTTTAATAAAGAATACGATTGCTGTGTTAGC
ATTGATAAAGGAGGATTTATTGAAATTTGGGACCCAAAGACTTTTGATTTTCCTGAGAAT
AGTAAGTTCAAGTTCAGCTCTAAGCTTTAAACAGATTATTTCGAGTTATTGAAGAAGTAA
GTTGTACCCTTAGGAGCTTGTTTGTCTAACAATGGCTAATATTTAGCTATTTACGGCAGT
GATAAGCAAATTCGTATTTTTAATTTTAAGACAGGCAAAATAATTCACACTATTGATGAA
AGTGACAAGCGTATTTAAGAAATTTAAGATAATGATTAAGATCCAGAATACAAATTGCAT
AAGTTAGATAAATTTGCTTTCAGTAGACGTATGGCTACAGAGAGAGAAACCGAAAAAATA
TTTGATCCTACAAATTTGGAAGCCAATAGCATTTCCCTTTAATTTGACGAAAACAACGAA
ATGTTAGTTTACCCAACACTGGTTGGTATTAAATACTACTCTTTGTCTAAAGCAAAAATA
GTCTAAGTTTAAGGTAAAAACGAACAAGAACGCTTTCTTAAATTATTCCTCTATCAAGGT
AAGCCCATGAAAAATCCAAGCAACACTGGTGGTTCTTAAAAGCTTGCATCAGACCCTCTA
CTCATAGCTTCTGCATTCAAGAAAAATCGTTTCTATTTGTTTTCAGGTAGAGAACCTGAA
GATTAGCAAGATAAGATTTTATCAAGAGATGTATTAAATGAGCGTCCTTCAAAAGAAGAA
CAATAAATGGCATCCTAACTTCTAAGTTAGCAACAAGAAAAGAAAAATAACTCAACAGCT
AGCTCCGCAAGAATAGAAACCACATAAGGTGACATTGAAGTAGAGCTCTATGATAAATTA
GTACCAAAGACAGTAGAAAACTTTGTAACTCATTCTAAAAATGGCTACTATAATAATCTC
ATTTTCCATAGAGTTATACCTAATTTCATGATTCAAACAGGTTGTCCTAAAGGTGATGGA
ACAGGAGGAGAGTCAATTTGGGGTGGCGAGTTTGAAGATGAGTTTCATCCTAAGCTTAAG
CATGATAAAGCAGGCACTCTTTCTATGGCAAATGCTGGTCCAAATACAAATGGATCCTAA
TTTTTCATAACATGCAATCCAACTGAGTGGTTGGATAATAAGCACACTGTTTTTGGAAGA
GTTACAAAAGGAATGGATATTGTTTAATAAATTGCTACAGCAAAAAAAGATAAATTTGAT
AGACCTTTAAAAGATATAAAAATTAGAACTATTGTGATTATATCCTGA


>TTHERM_00075590(protein)
MSDSEESKVSQNEKKQQLIKQNQQRKQNLESADVGPSVKLLKNIDIVDVLLKNVPSGEMY
EKSYMHREVVNMIIGAPKNDTIITISVDGHVKFWRKIYQLIEQIKYFRCHKGPVTGACIS
LSQDSLITVCASDQTMKKFDLLSTDLNNFQKFDFRPATCQFVQLDDRETTYLCVSDFDSG
KINVYDDVNEEKLNLVKTLEIHSNSVRFLFFNKEYDCCVSIDKGGFIEIWDPKTFDFPEN
SKFKFSSKLQTDYFELLKKQVVPLGACLSNNGQYLAIYGSDKQIRIFNFKTGKIIHTIDE
SDKRIQEIQDNDQDPEYKLHKLDKFAFSRRMATERETEKIFDPTNLEANSISLQFDENNE
MLVYPTLVGIKYYSLSKAKIVQVQGKNEQERFLKLFLYQGKPMKNPSNTGGSQKLASDPL
LIASAFKKNRFYLFSGREPEDQQDKILSRDVLNERPSKEEQQMASQLLSQQQEKKNNSTA
SSARIETTQGDIEVELYDKLVPKTVENFVTHSKNGYYNNLIFHRVIPNFMIQTGCPKGDG
TGGESIWGGEFEDEFHPKLKHDKAGTLSMANAGPNTNGSQFFITCNPTEWLDNKHTVFGR
VTKGMDIVQQIATAKKDKFDRPLKDIKIRTIVIIS


>TTHERM_00075590(gene)
ATGAGTGACAGCGAAGAAAGCAAAGTTTCTTAAAACGAAAAAAAATAATAGCTTATCAAA
TAAAATTAGTAAAGAAAATAAAACTTAGAAAGCGCAGATGTTGGTCCTTCTGTTAAGTTA
TTAAAAAATAGTAATTTGAATTGAATTTATCTGTTTTTTTGAAAAATAATCATCATAAAA
TAATAGTTGATATTGTTGATGTGCTATTAAAAAATGTTCCAAGTGGAGAAATGTATGAAA
AAAGTTACATGCATAGGGAGGTTGTTAATATGAGTAAAGCTTATAAATTAATTTCTAAAA
GTATTTAATTTTATTCTTTATATTTTACTTAGTTATAGGAGCTCCTAAAAACGATACGAT
TATCACAATTAGTGTAGACGGACATGTCAAATTTTGGAGAAAAATTTATCAACTAATTGA
ACAAATCAAATACTTTAGATGTCATAAAGGTCCAGTAACAGGAGCATGTATTTCTTTGAG
TTAAGATTCTCTTATTACTGTTTGTGCTTCTGACTAAACCATGAAGAAATTCGATTTACT
GAGCACTGATTTAAATAACTTTTAGAAATTCGATTTTAGACCTGCCACTTGCTAATTTGT
TTAGTTAGATGACAGAGAAACAACATACTTATGTGTGTAAATAAATTTATAAACATATTT
AAAAACAAATAAATTTTTTATTAAATACAAATTTTAAATTAACTTATAAAAATTTTTTTT
TTTTAAAGAAATTTCAAAAATTTTTTATTTTTAAATAAAATCTAGATAAACTTTTGTAGT
TTTATTTAGAAATTTAAAATAATATTTGATTTTTTTGAAATATTTTGCTGAAAAATTCAT
GTTTGTTATTTTAATATATAGGAGTGATTTCGATAGTGGAAAAATTAATGTTTATGATGA
TGTCAATGAAGAAAAATTAAATTTGGTAAAGACTCTTGAAATACATTCTAATTCAGTTAG
GTTCTTGTTCTTTAATAAAGAATACGATTGCTGTGTTAGCATTGATAAAGGAGGATTTAT
TGAAATTTGGGACCCAAAGACTTTTGATTTTCCTGAGAATAGTAAGTTCAAGTTCAGCTC
TAAGCTTTAAACAGATTATTTCGAGTTATTGAAGAAGTAAGTTGTACCCTTAGGAGCTTG
TTTGTCTAACAATGGCTAATATTTAGCTATTTACGGCAGTGATAAGCAAATTCGTATTTT
TAATTTTAAGACAGGCAAAATAATTCACACTATTGATGAAAGTGACAAGCGTATTTAAGA
AATTTAAGATAATGATTAAGATCCAGAATACAAATTGCATAAGTTAGATAAATTTGCTTT
CAGTAGACGTATGGCTACAGAGAGAGAAACCGAAAAAATATTTGATCCTACAAATTTGGA
AGCCAATAGCATTTCCCTTTAATTTGACGAAAACAACGAAATGTTAGTTTACCCAACACT
GGTTGGTATTAAATACTACTCTTTGTCTAAAGCAAAAATAGTCTAAGTTTAAGGTAAAAA
CGAACAAGAACGCTTTCTTAAATTATTCCTCTATCAAGGTAAGCCCATGAAAAATCCAAG
CAACACTGGTGGTTCTTAAAAGCTTGCATCAGACCCTCTACTCATAGCTTCTGCATTCAA
GAAAAATCGTTTCTATTTGTTTTCAGGTAGAGAACCTGAAGATTAGCAAGATAAGATTTT
ATCAAGAGATGTATTAAATGAGCGTCCTTCAAAAGAAGAACAATAAATGGCATCCTAACT
TCTAAGTTAGCAACAAGAAAAGAAAAATAACTCAACAGCTAGCTCCGCAAGAATAGAAAC
CACATAAGGTGACATTGAAGTAGAGCTCTATGATAAATTAGTACCAAAGACAGTAGAAAA
CTTTGTAACTCATTCTAAAAATGGCTACTATAATAATCTCATTTTCCATAGAGTTATACC
TAATTTCATGATTCAAACAGGTTGTCCTAAAGGTGATGGAACAGGAGGTAAAATAAAATA
AAAAAATAAATAATTTTAAAAAAATTAATTTGCTAATAAATGAACGAAAAATTAGTTCTA
TGAATAGCTTTTTAAGAAGCATATTTGTTCTAGTTAAAAAATAACTAATTTATTTTTAAA
ATTTTAGGAGAGTCAATTTGGGGTGGCGAGTTTGAAGATGAGTTTCATCCTAAGCTTAAG
CATGATAAAGCAGGCACTCTTTCTATGGCAAATGCTGGTCCAAATACAAATGGATCCTAA
TTTTTCATAACATGCAATCCAACTGAGTGGTTGGATAATAAGGTATATTAATTGTAAAAA
CTATTTTATATTTAAATTTTAATGAATTATAAAAAGCACACTGTTTTTGGAAGAGTTACA
AAAGGAATGGATATTGTTTAATAAATTGCTACAGCAAAAAAAGATAAATTTGATAGACCT
TTAAAAGATATAAAAATTAGAACTATTGTGATTATATCCTGA