Identifiers and Description

Gene Model Identifier

TTHERM_00492720

Standard Name

PPI10 (peptidylprolyl isomerase 10)

Aliases

PreTt04208 | 61.m00195 | 3711.m00043

Description

peptidyl-prolyl cis-trans isomerase, cyclophilin-type family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF06519 ) TolA protein
  • ( PF00160 ) peptidyl-prolyl cis-trans isomerase, cyclophilin-type

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00492720

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12968.19.997093137033517e-262peptidyl-prolyl cis-trans isom
erase, cyclophilin-type family
protein (582 aa)
OxytrichaContig6099.0.g216.002330506118426e-84Cyclophilin type peptidyl-prol
yl cis-trans isomerase/CLD
WormBaseWBGene000008921.99927841627239e-68locus:cyn-16 status:Partiall
y_confirmed UniProt:Q9XXI7
protein_id:CAA19454.2
DictyBaseDDB_G02683586.000608367221491e-63DDB_G0268358 on chromosome: 1
position 936052 to 938060
Stentor CoeruleusSteCoe_343497.281290178321643e-33
SGDYHR057C2.9993110246221282e-28CPR2 Peptidyl-prolyl cis-trans
isomerase (cyclophilin), cata
lyzes the cis-trans isomerizat
ion of peptide bonds N-termina
l to proline residues; has a p
otential role in the secretory
pathway

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00492720(coding)
ATGTCAAGCGTTTACTCTCTAGAACCACCAACTAGTGGCAAAGTTATAATTAGAACTTCA
ATGGGAGACATTGATGTAGAGTTATGGACTCTTGAGGCTCCAAAAGCTTGTAGAAATTTT
ATTTAATTGTGCCTTGAAGGATATTATGATGATACAATATTTCATAGATTGATTCCAAAG
TTTATGATTTAAGGTGGAGATCCCACAGGCACGGGAAAGGGAGGAGAAAGTATTTATGGA
GAGCCATTTAAAGATGAATTTCATTAAAGATTAAAATTTTCACATAGAGGTATTGTAGCT
ATGGCAAATGAAAGCAAACCTAACACTAACACTAGTTAATTTTTTATAACATTTGATGAG
TGTACTTGGCTTGATAAGAAGCATACTATATTTGGAAAAGTAACTGGTGATTCTGTGTAT
AATTTGCTTTAACTTCAATAGGTAGAAACAGATTAAAATGATAGACCATTGAATCCTCCA
AGAATTATCAAAACAAATGTAGTATAAAATCCGTTTGATGATATTGTTCTAAGAAGCGAT
TAAGCCATAAAATTTTCAAAATTGAACCAAAACAAAGATTAAAAGTATAGCAGTGGATCT
GAATCAGAAGAAGATGAAGAAGAACAAAGGTTTAAAATAGAAAATGAGAAAAGAAAGAAA
GAAATGCTTATATAAAAGCAAAAAGAGGAGGAATAAAAGAAAAAGAACTTTTAAAATAAA
AACTTACTTTCTTTTGCTGATGATGATGAAGAGGAAGAAGATGGCATAGAAGAAAATGGT
GATGATGATGAAAAAGAAGAAGGAAACAATAAAAACAGTAATAAAGATGATTTCAAGAAA
CCATAAGACAAATGTTAAATAATGAATATTCATGATATAAGTGAGGAAGATAAATTTAGC
AAAGAAACAGCAGTAGATATAGAAAATTTACAAAAAAAGAAGTAATAAATAGAAGAGGAA
GAAAATAAAAAAAAGAGATTGTAAGACAGAGTAAAATCAGCAAAATAAGATGGAGTGAAA
GAAGAGATAAATAAAAAGTTATTTAAAGAAAATGAAGTCATTGAAGTAAAAGGGAAATTA
GCAGAAGAAAATAAAGATTTGCTCAATTACAAGAAAAGAATTAATAAATAAACAGGTAAA
GTTGAATTATATTGGGATAATGAAGGAGAATAATCAAAATCAGAGAGTGATCAAGAATCT
TATTCCTCAACAGACTCAGAAGATTATCAAAATGAAGAAGAAAAGAAAATTAGACAAAAA
CAAAAGGAGGAGTATGAAAATTTAAGAATATCTTTCTTGTAATAAAAACGAGATGGTTAA
GGAACAGCTTCAGAATCAGCAAGGAAAAATAAATCAGAGAACAATAAACTACTTACTAAT
GTAGAAAAAAGGAGGTAAAAGTATTTGGAAAAAGAATAGTTAGAAAGGCGTTAAGGAGGT
TACATGAAGAAGTTAGCTGAATTTTAGTAAAAAATGAAGGTTGTTTCAAATCCAAATAGC
TGGGTAAAGCATGAACTTAGATTCTAAGCAACTGGTGACAGAGCCTTTTAGATTTTTGAT
GCTAAAGAAAAAATTAAAGAATACAATGTTAATGAGGACTTGGAAAAGAAAGGATATGTA
AATAAAAGCTTGGATAATCTTAAAAGAAATATAGAGAAACGCTAAGAAGAGAGCCAAAAA
AGAGTAGGAGAAAAGTTGACTGTAGAAGAGTTAATGAAGTTAGCAGATGAATGA


>TTHERM_00492720(protein)
MSSVYSLEPPTSGKVIIRTSMGDIDVELWTLEAPKACRNFIQLCLEGYYDDTIFHRLIPK
FMIQGGDPTGTGKGGESIYGEPFKDEFHQRLKFSHRGIVAMANESKPNTNTSQFFITFDE
CTWLDKKHTIFGKVTGDSVYNLLQLQQVETDQNDRPLNPPRIIKTNVVQNPFDDIVLRSD
QAIKFSKLNQNKDQKYSSGSESEEDEEEQRFKIENEKRKKEMLIQKQKEEEQKKKNFQNK
NLLSFADDDEEEEDGIEENGDDDEKEEGNNKNSNKDDFKKPQDKCQIMNIHDISEEDKFS
KETAVDIENLQKKKQQIEEEENKKKRLQDRVKSAKQDGVKEEINKKLFKENEVIEVKGKL
AEENKDLLNYKKRINKQTGKVELYWDNEGEQSKSESDQESYSSTDSEDYQNEEEKKIRQK
QKEEYENLRISFLQQKRDGQGTASESARKNKSENNKLLTNVEKRRQKYLEKEQLERRQGG
YMKKLAEFQQKMKVVSNPNSWVKHELRFQATGDRAFQIFDAKEKIKEYNVNEDLEKKGYV
NKSLDNLKRNIEKRQEESQKRVGEKLTVEELMKLADE


>TTHERM_00492720(gene)
ATGTCAAGCGTTTACTCTCTAGAACCACCAACTAGTGGCAAAGTTATAATTAGAACTTCA
ATGGGAGACATTGATGTAGAGTTATGGACTCTTGAGGCTCCAAAAGCTTGTAGAAATTTT
ATTTAATTGTGCCTTGAAGGATATTATGATGATACAATATTTCATAGATTGATTCCAAAG
TTTATGATTTAAGGTGGAGATCCCACAGGCACGGGAAAGGGAGGAGAAAGTATTTATGGA
GAGCCATTTAAAGATGAATTTCATTAAAGATTAAAATTTTCACATAGAGGTATTGTAGCT
ATGGTAATTATAAGTTAATAGATAATTTTTAGCTATGTGAATAATGATTTTAATTGATAT
AATTAGGCAAATGAAAGCAAACCTAACACTAACACTAGTTAATTTTTTATAACATTTGAT
GAGTGTACTTGGCTTGATAAGAAGCATACTATATTTGGAAAAGTAACTGGTGATTCTGTG
TATAATTTGCTTTAACTTCAATAGGTAGAAACAGATTAAAATGATAGACCATTGAATCCT
CCAAGAATTATCAAAACAAATGTAGTATAAAATCCGTTTGATGATATTGTTCTAAGAAGC
GATTAAGCCATAAAATTTTCAAAATTGAACCAAAACAAAGATTAAAAGTATAGCAGTGGA
TCTGAATCAGAAGAAGATGAAGAAGAACAAAGGTTTAAAATAGAAAATGAGAAAAGAAAG
AAAGAAATGCTTATATAAAAGCAAAAAGAGGAGGAATAAAAGAAAAAGAACTTTTAAAAT
AAAAACTTACTTTCTTTTGCTGATGATGATGAAGAGGAAGAAGATGGCATAGAAGAAAAT
GGTGATGATGATGAAAAAGAAGAAGGAAACAATAAAAACAGTAATAAAGATGATTTCAAG
AAACCATAAGACAAATGTTAAATAATGAATATTCATGATATAAGTGAGGAAGATAAATTT
AGCAAAGAAACAGCAGTAGATATAGAAAATTTACAGTATTCAAATATAAAATAAATTTAT
TGTAGAATAAAATTTATGATTTATTAAAAAGAAAAAAGAAGTAATAAATAGAAGAGGAAG
AAAATAAAAAAAAGAGATTGTAAGACAGAGTAAAATCAGCAAAATAAGATGGAGTGAAAG
AAGAGATAAATAAAAAGTTATTTAAAGAAAATGAAGTCATTGAAGTAAAAGGGAAATTAG
CAGAAGAAAATAAAGATTTGCTCAATTACAAGAAAAGAATTAATAAATAAACAGGTAAAG
TTGAATTATATTGGGATAATGAAGGAGAATAATCAAAATCAGAGAGTGATCAAGAATCTT
ATTCCTCAACAGACTCAGAAGATTATCAAAATGAAGAAGAAAAGTAAAATAAAATTCAAT
ATCATTTTAATGAGGGATTAATTAATAAAACAAATAAAATTAAGGAAAATTAGACAAAAA
CAAAAGGAGGAGTATGAAAATTTAAGAATATCTTTCTTGTAATAAAAACGAGATGGTTAA
GGAACAGCTTCAGAATCAGCAGTAAATATTGAAGTTAAAAATATAGATTTAATGATTACT
AAAAAAAACAGAGGAAAAATAAATCAGAGAACAATAAACTACTTACTAATGTAGAAAAAA
GGAGGTAAAAGTATTTGGAAAAAGAATAGTTAGAAAGGCGTTAAGGAGGTTACATGAAGA
AGTTAGCTGAATTTTAGTAAAAAATGAAGGTTGTTTCAAATCCAAATAGCTGGGTAAAGC
ATGAACTTAGATTCTAAGCAACTGGTGACAGAGCCTTTTAGATTTTTGATGCTAAAGAAA
AAATTAAAGAATACAATGTTAATGAGGACTTGGAAAAGAAAGGATATGTAAATAAAAGCT
TGGATAATCTTAAAAGAAATATAGAGAAACGCTAAGAAGAGAGCCAAAAAAGAGTAGGAG
AAAAGTTGACTGTAGAAGAGTTAATGAAGTTAGCAGATGAATGA