Identifiers and Description

Gene Model Identifier

TTHERM_00877050

Standard Name

PPI1 (peptidylprolyl isomerase 1)

Aliases

PreTt09701 | 156.m00085

Description

peptidyl-prolyl cis-trans isomerase, cyclophilin-type family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00160 ) peptidyl-prolyl cis-trans isomerase, cyclophilin-type

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00877050

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03176.13.998986577109865e-118peptidyl-prolyl cis-trans isom
erase, cyclophilin-type family
protein (250 aa)
DictyBaseDDB_G02691209.998819815181669e-76cypB on chromosome: 1 position
3371521 to 3372496
WormBaseWBGene000008772.9997879492220375e-71locus:cyn-1 Peptidyl-prolyl
cis-trans isomerase 1 status
:Confirmed UniProt:P52009
protein_id:CAA22075.1
OxytrichaContig22608.0.g342.000597631390999e-64Cyclophilin type peptidyl-prol
yl cis-trans isomerase/CLD
SGDYDR155C3.000745802558524e-63CPR1 Cytoplasmic peptidyl-prol
yl cis-trans isomerase (cyclop
hilin), catalyzes the cis-tran
s isomerization of peptide bon
ds N-terminal to proline resid
ues; binds the drug cyclospori
n A
Stentor CoeruleusSteCoe_243157.281290178321643e-33

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00877050(coding)
ATGAATAAGGGTTATTACTTATTAGTCGCTTTGGCAATTCTCGCAGTTGCTTCTGCCAAT
TTGAAGGAAGAAAAGATTACCAAGAAGGTCAGATTTACTGTTACATTCGATGGTAAGGAA
CCTGGTTTTGTTGAAATCGGTCTTTTCGGTTAAACTGTTCCCAAGACTGTTGAAAATTTC
CGTGCCCTCTGCACTGGTGAATTAGGTGAAAGTAATGGTCACAAGCTCTCTTACAAGGGA
TCTAAGTTCCACAGAATCATCCCTAACTTCATGGTTTAAGGAGGTGACTTCACCAACCAC
AATGGCACTGGTGGTCTTTCCATTTATGGTTCTAAATTCCAAGATGAAAACTTCAAGCTT
AGACACGAACCTTACTGCCTCTCTATGGCTAATGCTGGTCCTAACACCAACGGATCTCAA
TTCTTTATCACCACTGCTTAAACCAGTTGGTTAGATGGACGTCACGTTGTTTTCGGTAGA
GTTACTTAAGGTGAAGACATCGTCAGAAAGATCGAAGCTGCAGGTTCTCCTTCCGGTACT
CCTTCTAAGAACGTCGTTATTGCTGACTGTACTGAAGTTGATTTAGATTGA


>TTHERM_00877050(protein)
MNKGYYLLVALAILAVASANLKEEKITKKVRFTVTFDGKEPGFVEIGLFGQTVPKTVENF
RALCTGELGESNGHKLSYKGSKFHRIIPNFMVQGGDFTNHNGTGGLSIYGSKFQDENFKL
RHEPYCLSMANAGPNTNGSQFFITTAQTSWLDGRHVVFGRVTQGEDIVRKIEAAGSPSGT
PSKNVVIADCTEVDLD


>TTHERM_00877050(gene)
ATGAATAAGGGTTATTACTTATTAGTCGCTTTGGCAATTCTCGCAGTTGCTTCTGCCAAT
TTGAAGGAAGAAAAGATTACCAAGAAGGTCAGATTTACTGTTACATTCGATGGTAAGGAA
CCTGGTTTTGTTGAAATCGGTCTTTTCGGTTAAACTGTTCCCAAGACTGTTGAAAATTTC
CGTGCCCTCTGCACTGGTGAATTAGGTGAAAGTAATGGTCACAAGCTCTCTTACAAGGGA
TCTAAGTTCCACAGAATCATCCCTAACTTCATGGTTTAAGGAGGTGACTTCACCAACCAC
AATGGCACTGGTGGTCTTTCCATTTATGGTTCTAAATTCCAAGATGAAAACTTCAAGCTT
AGACACGAACCTTACTGCCTCTCTATGGCTAATGCTGGTCCTAACACCAACGGATCTCAA
TTCTTTATCACCACTGCTTAAACCAGTTGGTTAGATGGACGTCACGTTGTTTTCGGTAGA
GTTACTTAAGGTGAAGACATCGTCAGAAAGATCGAAGCTGCAGGTTCTCCTTCCGGTACT
CCTTCTAAGAACGTCGTTATTGCTGACTGTACTGAAGTTGATTTAGATTGA