Identifiers and Description

Gene Model Identifier

TTHERM_00378980

Standard Name

POT2 (protection of telomeres 2)

Aliases

PreTt10352 | 40.m00237 | KM406494

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00378980

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00078.17.002629310501235e-115hypothetical protein (482 aa)
OxytrichaContig22209.0.g660.000005998506718272351Telomeric single stranded DNA
binding POT1/CDC13

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:25303953: Cranert S, Heyse S, Linger BR, Lescasse R, Price C (2014) Tetrahymena Pot2 is a developmentally regulated paralog of Pot1 that localizes to chromosome breakage sites but not to telomeres. Eukaryotic cell 13(12):1519-29
  2. Ref:24297442: Premkumar VL, Cranert S, Linger BR, Morin GB, Minium S, Price C (2014) The 3' overhangs at Tetrahymena thermophila telomeres are packaged by four proteins, Pot1a, Tpt1, Pat1, and Pat2. Eukaryotic cell 13(2):240-5

Sequences

>TTHERM_00378980(coding)
ATGAAGCAAACCAGCTAACTTAAGACATTATCAGAGATTACCAAGGCTAAGAGTTTAAAA
TAAAGCATCATCATAGCTTTGATACTGGACTATACTAATAATTACTTGACTAGTCAAGGA
CCACTTGTAAGAATAAAAATAATAGATGACACATTTACATTTGAAAAAAAATAAAGCTCA
AAAGTGTATTTTCAGGTGCACAATCTGACTGATAAAAAATATATGATGAAAATAGGCGAT
ATCGTGTATGTAAAAGAATTCTAATCATTTAAATAGGATAAGCCTGAAATTTATGAAATA
GAAACTAGTTCTCATATACATGTATTTGAACAAAACAAATCTAATCTTTGGTGCACCAAC
TGCTAAAAGAATATCTTGCTTTGTGAGCAGTCTCAAAAAAGAATATAAGATCTTCGAGAC
TACAGCTTTAAAAAATTCTCTCAAATTAAATTAAAAGATTTATATTGGAAAGGCTTTACT
AATTCTGATTAAGTTATTAAATAAAACTTTGACTTGTTGTTGAAAGTAGATTAAATAGAA
TTAGTTAATCTTTAAGACATACCAAAGTATTACAATATTAGATTGGTAGATTCTGATCTT
AATTAATACTATTTAAAGGAGTAAAATAATGATTTAGAAGTAGGAGAGATTGTTAAAATT
AGATCTGTGCATTACTTTGTTTAATTACTAAGAGACAAAGAAAATCAAATTATAAAAAGT
GACTACACAAATGTGCAAAGACTTTATAGATTTTTTTATGATGTAGTGAATTTCGATAAA
TTTAAGTATGAAATAGTTAGATATGCAAAAGAAAATTATGATTTTGAAGAGTATTATCAT
GATTTATAAGATGAAAATAGAAAATTTTCTATCATAAAAAGGATTCATTAAAATAATTAT
AACATTACTTCTTTACAATTTCTATTGAACAAGCAGCAATCTAATGATTACTATTCTATC
AAGCATATGAAATACAGGATACAGTGCTACGTTATAGATATTCAGCCATCTTATTTATTA
GATGCTGTTAGAAGGATATCATACTTTGATAAAAAAATTAACTATCCTTTAAAGGATTCA
AATTTCAAAAATATGAATTAGCTAAAAAGAATTTTAGAAGTTTAAATTTTAGTCAAGGAC
ACTTCAATCGACTTGAACAAGGATGTAGTTAATATTATACTTATTTAAGAGGAGCTTCAA
AATGATCACGATTTTTTTAAAGGAGTTGAATTACTCAAAATCGAAGAAGAAAATGTATAA
GAGTATCAAAAAGTTTACTATAATATATTAAATAGACTATTTACAGAAACAAGCTCATCT
AAAATGGTGGATATTATAGTTAAACCATTCTTATTTCAATAAAAAATTTTATATAAAATT
ATTGACACTCAATTTCTCCCCTGA


>TTHERM_00378980(protein)
MKQTSQLKTLSEITKAKSLKQSIIIALILDYTNNYLTSQGPLVRIKIIDDTFTFEKKQSS
KVYFQVHNLTDKKYMMKIGDIVYVKEFQSFKQDKPEIYEIETSSHIHVFEQNKSNLWCTN
CQKNILLCEQSQKRIQDLRDYSFKKFSQIKLKDLYWKGFTNSDQVIKQNFDLLLKVDQIE
LVNLQDIPKYYNIRLVDSDLNQYYLKEQNNDLEVGEIVKIRSVHYFVQLLRDKENQIIKS
DYTNVQRLYRFFYDVVNFDKFKYEIVRYAKENYDFEEYYHDLQDENRKFSIIKRIHQNNY
NITSLQFLLNKQQSNDYYSIKHMKYRIQCYVIDIQPSYLLDAVRRISYFDKKINYPLKDS
NFKNMNQLKRILEVQILVKDTSIDLNKDVVNIILIQEELQNDHDFFKGVELLKIEEENVQ
EYQKVYYNILNRLFTETSSSKMVDIIVKPFLFQQKILYKIIDTQFLP


>TTHERM_00378980(gene)
ATGAAGCAAACCAGCTAAGTAAACCATAATATAAAGTTTATTAACTTCTATTTAAACATT
TTAAAAATTATTATCAGCTTAAGACATTATCAGAGATTACCAAGGCTAAGAGTTTAAAAT
AAAGCATCATCATAGCTTTGATACTGGACTATACTAATAATTACTTGACTAGTCAAGGAC
CACTTGTAAGAATAAAAATAATAGATGACACATTTACATTTGAAAAAAAATAAAGCTCAA
AAGTGTATTTTCAGGTGCACAATCTGACTGATAAAAAATATATGATGAAAATAGGCGATA
TCGTGTATGTAAAAGAATTCTAATCATTTAAATAGGATAAGGTAATAACTATTTAGGATA
ACTTAAATTAATATATTTTTTGTTTAATTAAGCCTGAAATTTATGAAATAGAAACTAGTT
CTCATATACATGTATTTGAACAAAACAAATCTAATCTTTGGTGCACCAACTGCTAAAAGA
ATATCTTGCTTTGTGAGCAGTCTCAAAAAAGAATATAAGATCTTCGAGACTACAGCTTTA
AAAAATTCTCTCAAATTAAATGTATGCTTAAATTTTTATTCTTTTTATTTATTTATTGAA
AAAATTGTATTTTGAAAAGTAAAAGATTTATATTGGAAAGGCTTTACTAATTCTGATTAA
GTTATTAAATAAAACTTTGACTTGTTGTTGAAAGTAGATTAAATAGAATTAGTTAATCTT
TAAGACATACCAAAGTATTACAATATTAGATTGGTAGATTCTGATCTTAATTAATACTAT
TTAAAGGAGTAAAATAATGATTTAGAAGTAGGAGAGATTGTTAAAATTAGATCTGTGCAT
TACTTGTAAGTAATTTTGTTTAGAATTTTAGTAATTTAAAAGTTAATTTATAGTGTTTAA
TTACTAAGAGACAAAGAAAATCAAATTATAAAAAGTGACTACACAAATGTGCAAAGACTT
TATAGATTTTTTTATGATGTAGTGAATTTCGATAAATTTAAGTATGAAATAGTTAGATAT
GCAAAAGAAAATTATGATTTTGAAGAGTATTATCATGATTTATAAGATGAAAATAGAAAA
TGTATTTTATTTAATTTAATTTAAATTTACAAATTTTTTATTTAAGGATTAAAATTTTAA
TTAAATTTATAAATAAATAAATAGTTTCTATCATAAAAAGGATTCATTAAAATAATTATA
ACATTACTTCTTTACAATTTCTATTGAACAAGCAGCAATCTAATGATTACTATTCTATCA
AGCATATGAAATACAGGATACAGTGCTACGTTATAGATATTCAGCCATCTTATTTATTAG
ATGCTGTTAGAAGGATATCATACTTTGATAAAAAAATTAAGTAATTTTTAAATACAAATA
TTTTATGATTTTTCATTTAAAATTTTTTTTTTCTAGCTATCCTTTAAAGGATTCAAATTT
CAAAAATATGAATTAGCTAAAAAGAATTTTAGAAGTTTAAATTTTAGTCAAGGACACTTC
AATCGACTTGAACAAGGATGTAGTTAATATTATACTTATTTAAGAGGAGCTTCAAAATGA
TCACGTATATACATATATATAATTTAAAATAGCTTATTAATTTCTGAAAATAATTAAATT
TTATTAGGATTTTTTTAAAGGAGTTGAATTACTCAAAATCGAAGAAGAAAATGTATAAGA
GTATCAAAAAGTTTACTATAATATATTAAATAGACTATTTACAGAAACAAGCTCATCTAA
AATGGTGGATATTATAGTTAAACCATTCTTATTTCAATAAAAAATTTTATATAAAATTAT
TGACACTCAATTTCTCCCCTGA