Identifiers and Description

Gene Model Identifier

TTHERM_000378989

Standard Name

POT1 (protection of telomeres 1)

Aliases

KM406495

Description

transmembrane protein putative

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_000378989

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00078.19.997093137033517e-262hypothetical protein (482 aa)
OxytrichaContig22209.0.g660.0000009995106777214876Telomeric single stranded DNA
binding POT1/CDC13

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:25303953: Cranert S, Heyse S, Linger BR, Lescasse R, Price C (2014) Tetrahymena Pot2 is a developmentally regulated paralog of Pot1 that localizes to chromosome breakage sites but not to telomeres. Eukaryotic cell 13(12):1519-29
  2. Ref:24297442: Premkumar VL, Cranert S, Linger BR, Morin GB, Minium S, Price C (2014) The 3' overhangs at Tetrahymena thermophila telomeres are packaged by four proteins, Pot1a, Tpt1, Pat1, and Pat2. Eukaryotic cell 13(2):240-5
  3. Ref:17158924: Jacob NK, Lescasse R, Linger BR, Price CM (2007) Tetrahymena POT1a regulates telomere length and prevents activation of a cell cycle checkpoint. Molecular and cellular biology 27(5):1592-601

Sequences

>TTHERM_000378989(coding)
ATGTTTTGTAAAGTAAATTTTAGTAAAAATATTATTAAATAAATATTTTTATTTTACATT
TTTTTTTTTAAATAATTGTTTTGCTTATTTACTTACATAAACGATAACCTTAATTTAATT
GTTAATAATTTATTTAAAATCTCTCGGAGTATTTATTGCGCCAAATCAATTTATTTAGAA
AAATATAATTAAAAAGTATTCATAAATAAATAGGAAAGTACAAGTAGCAAAAGCATACGC
GTTAATAAAACAGAATTTAAATATAAACTAAATAGTTGCAATATATAAATGAACTAACAC
AACGAAGAGTTCTTCACACTAAATGAGCTGTATCTGAAGTAGAAAAGAAGTATCCATATT
GTAGCAATTATTTTAGATTGCACAGCATAATATAAAACTGCAAACGACTATTTGACAAGA
ATAAAAATTATTGATGATACATTTGTGAAAGTTGATAATAACGACACTAAGAAAGGATAC
TTTGAAGTTTGCCAGTTCAGTTAATTAAGGTGCAAAAGTCCCAAAGTTTAGAAAATTGGG
GACATTATTTATTTAAGGAGATACAATGTTTCTGCTAACGATGACGATAGATTGTAAATC
TAGACAAACCACTAAGCAAAATGCAGCTTTCACATATTTGACTCAGAGTAATAGCATTAC
AATGTAATTGACTCTGACTATGATGGACAGCTATAAATTTCTGAGATACTATAGGAGAGG
ATTAAATAATTAAGAAGTTATTGCTTTTAAATATTTTCAACTAAGAGCTTAATGCAAATG
ATTTGGTATGGACTTGAACCTCAAAGAGAGAATTAAATCAATAAAAAAGACTTTGACATG
CTTTTAAGGATTTAGGATATTGAATAAATTTAAAATTTTGATGAAAGCCTTGACCCTATT
CCAATGGTAAAGCTTACATTAATAGATTCTGACAACAATAATTACTATCTTACATTCCAA
GACAGAAACTATACAAAAGGCTAGGTTGTCAAGATAAGATCTGTCCGCCATATAGAAAAC
GAAGGAGTTATTGTCAAGAATGATTATTCAAATGTCTTAAAACTCTCCAATTTCTTTTAT
GACTTCAAAAATTTCCAATAAATTAAATATGACATGATTGAATACATGAAAAATAATTTT
GATTTTGATGATTACATAGAAGATCCAAGCGATGAATACAGAAGATTTTCCGTCTTAAAG
AAGATCCACTCTACAAACAATACCATAACATCACTTTAGGATTTATTAAAGATACAAACA
AACCCTTCTCAATATAGCATAATCAAGACTTAAAAATTTAAAACGCAATGCTACATCGTT
GATATCTAACCTTAGACACTAGAAGAAGCTGTTAAAAAAGTTTCTTATATGAACCATAAT
ATTTGTGTGTCATTAAAAGACTCCAGCAATTATAATAAGCATGCTGAGCTTAACAGGATA
TTAGAAGCTTAAATTGTAGTGAAAGATTAATCTATTGACTCTACTCTAAATATTCTATAA
TTAGTTTTAATCTAAGAAGAAAGAGAAAAGCACCACGATTTCTTTAAAGGAGTTGAACTG
TAAAAAATAACATCAGAAAATATTTAATAATATGAACAAAACTACTAAAAAATTTGCTAG
AGATTATGTAGTCATTCAAATACTCATAGGACTGTAGACATCGTTGTTTAGCCAATTCTT
TTTAATGATAGAATTCTTTTTAGAATCGTTGATACTTAATTTCTACCCTGA


>TTHERM_000378989(protein)
MFCKVNFSKNIIKQIFLFYIFFFKQLFCLFTYINDNLNLIVNNLFKISRSIYCAKSIYLE
KYNQKVFINKQESTSSKSIRVNKTEFKYKLNSCNIQMNQHNEEFFTLNELYLKQKRSIHI
VAIILDCTAQYKTANDYLTRIKIIDDTFVKVDNNDTKKGYFEVCQFSQLRCKSPKVQKIG
DIIYLRRYNVSANDDDRLQIQTNHQAKCSFHIFDSEQQHYNVIDSDYDGQLQISEILQER
IKQLRSYCFQIFSTKSLMQMIWYGLEPQRENQINKKDFDMLLRIQDIEQIQNFDESLDPI
PMVKLTLIDSDNNNYYLTFQDRNYTKGQVVKIRSVRHIENEGVIVKNDYSNVLKLSNFFY
DFKNFQQIKYDMIEYMKNNFDFDDYIEDPSDEYRRFSVLKKIHSTNNTITSLQDLLKIQT
NPSQYSIIKTQKFKTQCYIVDIQPQTLEEAVKKVSYMNHNICVSLKDSSNYNKHAELNRI
LEAQIVVKDQSIDSTLNILQLVLIQEEREKHHDFFKGVELQKITSENIQQYEQNYQKICQ
RLCSHSNTHRTVDIVVQPILFNDRILFRIVDTQFLP


>TTHERM_000378989(gene)
ATGTTTTGTAAAGTAAATTTTAGTAAAAATATTATTAAATAAATATTTTTATTTTACATT
TTTTTTTTTAAATAATTGTTTTGCTTATTTACTTACATAAACGATAACCTTAATTTAATT
GTTAATAATTTATTTAAAATCTCTCGGAGTATTTATTGCGCCAAATCAATTTATTTAGAA
AAATATAATTAAAAAGTATTCATAAATAAATAGGAAAGTACAAGTAGCAAAAGTATTTAT
AATTGTTAAATTTAGAGAAGCAATATTAACTGAACCATTTTAATATAAACATAGGCATAC
GCGTTAATAAAACAGAATTTAAATATAAACTAAATAGTTGCAATATATAAATGAACTAAC
ACAACGAAGAGGTAAAATATTTGATATTTTTAGTAGCTTTTACACGCATCATGCATATGA
ATAAAAGATTGATTTATTGATTATTTTATTCATTTAGATAATTCATAATTTTCAAACGTT
TGCTCAATGAAATACATTTTAAATAATATAAAAAGTTCTTCACACTAAATGAGCTGTATC
TGAAGTAGAAAAGAAGTATCCATATTGTAGCAATTATTTTAGATTGCACAGCATAATATA
AAACTGCAAACGACTATTTGACAAGAATAAAAATTATTGATGATACATTTGTGAAAGTTG
ATAATAACGACACTAAGAAAGGATACTTTGAAGTTTGCCAGTTCAGTTAATTAAGGTGCA
AAAGTCCCAAAGTTTAGAAAATTGGGGACATTATTTATTTAAGGAGATACAATGTTTCTG
CTGTAAATATTAAGATATTTTGCTTTGTTTAATTATTCATATTAGGTCTAATTTCTTTAT
TAGTTTGTGTTTTTGTTTATTTACTCTACTAGCAATTTAGCAAATACAAGTAGAATGAGT
TTGATCATTGATTGAACTTTTAAAATATTAAAAAGAACGATGACGATAGATTGTAAATCT
AGACAAACCACTAAGCAAAATGCAGCTTTCACATATTTGACTCAGAGTAATAGCATTACA
ATGTAATTGACTCTGACTATGATGGACAGCTATAAATTTCTGAGATACTATAGGAGAGGA
TTAAATAATTAAGAAGTTATTGCTTTTAAATATTTTCAACTAAGAGCTGTAAATATATAA
TATTTTATATCAACTTTTTAGACATATTGTTTTTGTATTAAATTAGTAATGCAAATGATT
TGGTATGGACTTGAACCTCAAAGAGAGAATTAAATCAATAAAAAAGACTTTGACATGCTT
TTAAGGATTTAGGATATTGAATAAATTTAAAATTTTGATGAAAGCCTTGACCCTATTCCA
ATGGTAAAGCTTACATTAATAGATTCTGACAACAATAATTACTATCTTACATTCCAAGAC
AGAAACTATACAAAAGGCTAGGTTGTCAAGATAAGATCTGTCCGCCATATGTAAAAATTT
GTGCAAATATTAATAATAACTCTAATATCTATAAATAAAATAGAGAAAACGAAGGAGTTA
TTGTCAAGAATGATTATTCAAATGTCTTAAAACTCTCCAATTTCTTTTATGACTTCAAAA
ATTTCCAATAAATTAAATATGACATGATTGAATACATGAAAAATAATTTTGATTTTGATG
ATTACATAGAAGATCCAAGCGATGAATACAGAAGATGTAATCAAAAAAAAAAAAAAATAA
ATAAATAAATAAAGGGGGAACTTTATAATTTTTTTTTATTTGACAAAAGTTTCCGTCTTA
AAGAAGATCCACTCTACAAACAATACCATAACATCACTTTAGGATTTATTAAAGATACAA
ACAAACCCTTCTCAATATAGCATAATCAAGACTTAAAAATTTAAAACGCAATGCTACATC
GTTGATATCTAACCTTAGACACTAGAAGAAGCTGTTAAAAAAGTTTCTTATATGAACCAT
AATATTTGGTAAAAATGAATTAAAGAAAATGTTATTCTAAATTATAGTTTGATAAAATAG
TGTGTCATTAAAAGACTCCAGCAATTATAATAAGCATGCTGAGCTTAACAGGATATTAGA
AGCTTAAATTGTAGTGAAAGATTAATCTATTGACTCTACTCTAAATATTCTATAATTAGT
TTTAATCTAAGAAGAAAGAGAAAAGCACCACGTAAATAATTATTATGTATTAGAAAATAA
AAGCTCATTGTATAAAAAAAGGATTTCTTTAAAGGAGTTGAACTGTAAAAAATAACATCA
GAAAATATTTAATAATATGAACAAAACTACTAAAAAATTTGCTAGAGATTATGTAGTCAT
TCAAATACTCATAGGACTGTAGACATCGTTGTTTAGCCAATTCTTTTTAATGATAGAATT
CTTTTTAGAATCGTTGATACTTAATTTCTACCCTGA