Identifiers and Description

Gene Model Identifier

TTHERM_00222280

Standard Name

POP1 (Ribonucleases P/MRP protein subunit POP1)

Aliases

PreTt12435 | 19.m00227

Description

Ribonucleases P/MRP protein subunit

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF08170 ) POPLD (NUC188) domain
  • ( TIGR01784 ) conserved hypothetical protein
  • ( PF06978 ) Ribonucleases P/MRP protein subunit POP1

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00222280

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05553.19.997093137033517e-262ribonuclease P/MRP protein sub
unit POP1 containing protein (
757 aa)
DictyBaseDDB_G02913206.002971818577897e-50pop1 on chromosome: 6 position
120925 to 123655
OxytrichaContig1019.1.g972.0003218023735366e-33Ribonucleases P/MRP protein su
bunit POP1
Stentor CoeruleusSteCoe_86483.221340285992516e-27
WormBaseWBGene000154862.0002795641672355e-21Uncharacterized protein C05D11
.9 status:Confirmed UniPro
t:Q11188 protein_id:CCD63199
.1
SGDYNL221C0.00000030014504373857585POP1 Subunit of both RNase MRP
and nuclear RNase P; RNase MR
P cleaves pre-rRNA, while nucl
ear RNase P cleaves tRNA precu
rsors to generate mature 5 end
s and facilitates turnover of
nuclear RNAs; binds to the RPR
1 RNA subunit in RNase P

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00222280(coding)
ATGCAAGATAATTAAGCAAATAGTGATATTGTAATTGAAGATCGTCATATAAATGTGAGC
CAATTCTTAGAAGCTAGAAGTTCAGAGATTGGCTACTTTACTCAGCAATTAAACTCAAAA
AAGAATGGATCAAATAAACTAGCTTATTAGATGGTCAAAAAGCATTTAAGAAGAAGAGCT
ATGTCTCATAATAGATACAGAATTCCAAGCAGAATCAGAAATAGAATGAATGTATAAGAA
TTAGATGTTATTGAAAAGACTTAAGACCCAATCAAATGTCGCAAGCACTTGAGAAAACCT
AAATTACTAATGAACTCATATATCAGAAGATCAAGAAGCGATAAATGGATGGAAACCCAT
TTATGGCATGCAAAAAGAATGAGAATGATCAAATATTTCCAATATAAAATAGCTAGGACT
CCAAATGAGAAAGGTGATAGAGCTTGCTTTAGATTTGCTAATCATGATTGCACAGTTTAT
GATAGAAGCTACTATGAATTTATTTTTATTTAGGGATCAAAAATATTAGAGTTTATGGCT
AGTCATTTATAATAAAAGGACTATAAAATTTTAATTTAAAATTAGAAGAAGAATTTCAAA
ATCAGTGATAATTTAGATGTTTATAAAAACGAATTAAATACACTTATTGGTCCTGCAAAA
TTTATTTGGAAAACAGAATAAGAATTGGTAGTGTTTATACATCCTGGCTGTGTCTCTGAG
TGGATCTAAATTTTAACTCTTTATGCTAAGAAGTTTGAAAATCAAACTGATGAGCAGAAA
GGAGGTTTGCTAGATTTTTAACATGTTAAAGACAATTATAATATCTTTGATCTGTCTGGT
CCACTCTGCTTGTACAAAGTACACTATCTCTTAGCTAATTTAGGATTGTCTGAAGAATAA
ATAAATAATATTCATCCACTCGTTCGTCATTTTAAAAATGTAAATGATGCAGCTAACTAT
CCTAAAAATCATATTATTTAGTTGAAATTCTAAGCAAATGTCAGCAAAAAATTGATTAAA
CCTCCTTTTGATTTTTCCTAAGTGTGTGTTGAAGAAAATCCTTTGAACTAAGATTAACTT
AATTAAAGTCTAGTTGATTTGATAACTTATAGCAAATAAGTTAAGCAAGAAAACATCAGC
TTGCTAGAAAACATAAAAGAAATCAAATAAAGCGATTATGCTGTAAGATTCAAAACTGTA
ACAAGAAATAGATACACTCATAAAAAGAAGAATAAAATTTCAAAAAAACAAAAGACCAAT
GCTTTAAGTCAAGTTAAGATTGAAGAAAAAAAGAAATACGAAGATTAAAAATAGTAATAA
CAGCAACAACAATTAAATTAAACTGAGTAAATTTAGGAAGAATCTAAGATCTAAACAGAA
GAGGTAGAAGCACAAAGTAATAATTCTATCCAACTCGAAGAAATTAAGTTTGCAAAGGAT
TTGGTTGAAAGTGAAATTCATTTAATGATAATATTTAACAATTCAAAGCAACACAAGGCC
TTTGGACAAGGAGTTACTTTGGTGGTTAATTAAGGAAGAGGTATCTTGGTTTGGAGATTA
CTGTCATTTATAGCTTGCAAAGCTATTGGCCTAAGTGAATATAATAATATTATTGAAGAA
AGTGGTCAGAAAGTATTTCCTAATGATTACCCTTTAACTTAGGCATACAGCACTTTAAAC
AAAGAATTGCTTGAAGCAAAAGTAACTAAACATTTCCTGAAACCTAAAGGTAAAAGAGTA
AATTATATGAAGATAAACTCACCTTTCCCTTTTAAACCTAATTTCGATTACATTTTGAGT
AAATATCTTGAGAGTGAAGATAAGATAATTGCTCAGCAAGAAGATCTATAAGATGTTAGA
GTTATTATGGTAGGCAGGGGAAAGCCTGATACTAATTCTTACATTTGTTTGCCAGAGCCA
GAAGATTTCAAAAAATACTAAGATATGCTCTTAAAAGACAAATCCAGAGTTTATTCTATT
CACGATGAGCCTTCTTATGTAAAAGTAGCTTCTAAATCGCTTGATATTCCAGAACCCTCT
CAAATCAGCACAACAAGAAAAATTATCGGGTTTTTATCATTTGGAGATTTTTCATTTAAA
TCTGGAGTTGGAAAGGGAAGAGGCTAAATCATAAAGTATTATTTGGATGCTTTAAAAGCT
AAAAGCCAAGGAAACAACATGGAAATAGAGGATAAGCAAAAAAATAAAAAATAAAATGAA
ATATTCTGCTTAATCCGTAATCCTACTTCAAGAAAGTACTATTTGGCAAACCTTTATTTA
ATTTGA


>TTHERM_00222280(protein)
MQDNQANSDIVIEDRHINVSQFLEARSSEIGYFTQQLNSKKNGSNKLAYQMVKKHLRRRA
MSHNRYRIPSRIRNRMNVQELDVIEKTQDPIKCRKHLRKPKLLMNSYIRRSRSDKWMETH
LWHAKRMRMIKYFQYKIARTPNEKGDRACFRFANHDCTVYDRSYYEFIFIQGSKILEFMA
SHLQQKDYKILIQNQKKNFKISDNLDVYKNELNTLIGPAKFIWKTEQELVVFIHPGCVSE
WIQILTLYAKKFENQTDEQKGGLLDFQHVKDNYNIFDLSGPLCLYKVHYLLANLGLSEEQ
INNIHPLVRHFKNVNDAANYPKNHIIQLKFQANVSKKLIKPPFDFSQVCVEENPLNQDQL
NQSLVDLITYSKQVKQENISLLENIKEIKQSDYAVRFKTVTRNRYTHKKKNKISKKQKTN
ALSQVKIEEKKKYEDQKQQQQQQQLNQTEQIQEESKIQTEEVEAQSNNSIQLEEIKFAKD
LVESEIHLMIIFNNSKQHKAFGQGVTLVVNQGRGILVWRLLSFIACKAIGLSEYNNIIEE
SGQKVFPNDYPLTQAYSTLNKELLEAKVTKHFLKPKGKRVNYMKINSPFPFKPNFDYILS
KYLESEDKIIAQQEDLQDVRVIMVGRGKPDTNSYICLPEPEDFKKYQDMLLKDKSRVYSI
HDEPSYVKVASKSLDIPEPSQISTTRKIIGFLSFGDFSFKSGVGKGRGQIIKYYLDALKA
KSQGNNMEIEDKQKNKKQNEIFCLIRNPTSRKYYLANLYLI


>TTHERM_00222280(gene)
ATGCAAGATAATTAAGCAAATAGTGATATTGTAATTGAAGATCGTCATATAAATGTGAGC
CAATTCTTAGAAGCTAGAAGTTCAGAGATTGGCTACTTTACTCAGCAATTAAACTCAAAA
AAGAATGGATCAAATAAAGTAATATATTGATTGAAAAATATGATTTTTAAAAAAGTAGAA
TTAGATAATTGCAGTTAAATATCTTGTTATTGCAAGTTAATTTGTTTGATTTATTAAATA
AATAGCTAGCTTATTAGATGGTCAAAAAGCATTTAAGAAGAAGAGCTATGTCTCATAATA
GATACAGAATTCCAAGCAGAATCAGAAATAGAATGAATGTATAAGAATTAGATGTTATTG
AAAAGACTTAAGACCCAATCAAATGTCGCAAGCACTTGAGAAAACCTAAATTACTAATGA
ACTCATATATCAGAAGATCAAGAAGCGATAAATGGATGGAAACCCATTTATGGCATGCAA
AAAGAATGAGAATGATCAAATATTTCCAGTAAGTATTTTCTCATATTTTAGATCATAAAA
ATTAACAAAAGCCTAAAAATAAATTAATTCAATAGCTTAATTTTGCACTTAAAAAACAAA
AATATTTTAAAATGAAAAATGACTAAATTTAATTTTAATAAACAAAAAACAAATATTTTT
TTTAAATAAAAAATTCTTCATGATTTAAAGAAATGCAAAATAAACCATAAATAAATAAAC
AAGCAAGTAAATGTGTTAAATTATCTTAAGAAGCAAAAATAAATTATTATTAAAATATTA
AATAGAATAAAAAATCAATCATTTTTAATTGAAAATAAAACTAATTTCATTGTTTTAATT
AGTTAAAATAAAGGAGTAAAAATAAATTATGAATTCTAGCTAAATAATCGATTTCCTTCT
AAACAAATAATAATTTATTTACTTTCTAATAGCAAAAATCTTAAGAAATTTAATACAAAA
TTAAAAAGTATTTCATTTTTATAAAAAGCAAAAACTAAAGAATTTATTAAAATAAAGATT
TTTATTTAGACAAAATAAATAGAAAATATTCTGAAATGTGAAATGGAAACGATTGATTTA
TTTATTTATGATTTAATTATATTTTTTAATAAAAATTTTAGATGAATTAAGTTTAAATTT
TAATGTGTTTATTTTTTAAGATATAAAATAGCTAGGACTCCAAATGAGAAAGGTGATAGA
GCTTGCTTTAGATTTGCTAATCATGATTGCACAGTTTATGATAGAAGCTACTATGAATTT
ATTTTTATTTAGGGATCAAAAATATTAGAGTTTATGGCTAGTCATTTATAATAAAAGGAC
TATAAAATTTTAATTTAAAATTAGAAGAAGAATTTCAAAATCAGTGATAATTTAGATGTT
TATAAAAACGAATTAAATACACTTATTGGTCCTGCAAAATTTATTTGGAAAACAGAATAA
GAATTGGTAGTGTTTATACATCCTGGCTGTGTCTCTGAGTGGATCTAAATTTTAACTCTT
TATGCTAAGAAGTTTGAAAATCAAACTGATGAGCAGAAAGGAGGTTTGCTAGATTTTTAA
CATGTTAAAGACAATTATAATATCTTTGATCTGTCTGGTCCACTCTGCTTGTACAAAGTA
CACTATCTCTTAGCTAATTTAGGATTGTCTGAAGAATAAATAAATAATATTCATCCACTC
GTTCGTCATTTTAAAAATGTAAATGATGCAGCTAACTATCCTAAAAATCATATTATTTAG
TTGAAATTCTAAGCAAATGTCAGCAAAAAATTGATTAAACCTCCTTTTGATTTTTCCTAA
GTGTGTGTTGAAGAAAATCCTTTGAACTAAGATTAACTTAATTAAAGTCTAGTTGATTTG
ATAACTTATAGCAAATAAGTTAAGCAAGAAAACATCAGCTTGCTAGAAAACATAAAAGAA
ATCAAATAAAGCGATTATGCTGTAAGATTCAAAACTGTAACAAGAAATAGATACACTCAT
AAAAAGAAGAATAAAATTTCAAAAAAACAAAAGACCAATGCTTTAAGTCAAGTTAAGATT
GAAGAAAAAAAGAAATACGAAGATTAAAAATAGTAATAACAGCAACAACAATTAAATTAA
ACTGAGTAAATTTAGGAAGAATCTAAGATCTAAACAGAAGAGGTAGAAGCACAAAGTAAT
AATTCTATCCAACTCGAAGTAACAAATTTGTTTTATTTACAAATGATTTAAAGATATTAA
ATTCACTAAATATTTAATAAACATAAAATATTTTTAATTTAATTTCTCAAAACTGTTTAA
TAAAATCAAATTAAAAAAATATCACACAAACAAATTTTGCTTTTTTATTTTAATTTTCAT
GAAAAATTAAATAAAAATTATTGAATTAATTTAATCAAATTCTAAAAAAAATAAAAAAAA
TAATTCAAATTCTTAAAAAATTAAATCTAAAATGAAATCAATATTTAAAATTAAACTAAT
TTATAATGAAAAAAGTTTATTTTTTATTAAATTTTTGAAACTTAAATTTCATTTTAAAAT
CCAAGAAATATTTATTTTAAGAATCCTGATTTTAATGTAAATCAAAAAATATTGATTAAA
TTAATAAATGTTTTTATAAATTCAAATTCGTTTCTTTTGAAAATTAAAGAAAATAATTAA
ATTTTAATACTAAAATTTAAAAATAAAATAAAAAATGTTTATAATATGAAATAGGAAATT
AAGTTTGCAAAGGATTTGGTTGAAAGTGAAATTCATTTAATGATAATATTTAACAATTCA
AAGCAACACAAGGCCTTTGGACAAGGAGTTACTTTGGTGGTTAATTAAGGAAGAGGTATC
TTGGTTTGGAGATTACTGTCATTTATAGCTTGCAAAGCTATTGGCCTAAGTGAATATAAT
AATATTATTGAAGAAAGTGGTCAGAAAGTATTTCCTAATGATTACCCTTTAACTTAGGCA
TACAGCACTTTAAACAAAGAATTGGTAAAAAATATTAATTTTGGTTTAGAAAGTATGTTT
AATAATTTGATTTGTAAACAAACAGCTTGAAGCAAAAGTAACTAAACATTTCCTGAAACC
TAAAGGTAAAAGAGTAAATTATATGAAGATAAACTCACCTTTCCCTTTTAAACCTAATTT
CGATTACATTTTGAGTAAATATCTTGAGAGTGAAGATAAGATAATTGCTCAGCAAGAAGA
TCTATAAGATGTTAGAGTTATTATGGTAGGCAGGGGAAAGCCTGATACTAATTCTTACAT
TTGTTTGCCAGAGCCAGAAGATTTCAAAAAATACTAAGATATGCTCTTAAAAGACAAATC
CAGAGTTTATTCTATTCACGATGAGCCTTCTTATGTAAAAGTAGCTTCTAAATCGCTTGA
TATTCCAGAACCCTCTCAAATCAGCACAACAAGAAAAATTATCGGTATTTGCTTGCTTTA
TTGCTTATTAAAATTTTTTCTTTCTTTCCAATTTTGAGTTATAAATTTAATCAAATTTTT
AAATTTTTTCTATTTTTATGGAATTTTGATTCAAGAAATTCGTTGATTTTCTAATCTTTT
TAATTAAATCTTTATTGTAAAAGGGTTTTTATCATTTGGAGATTTTTCATTTAAATCTGG
AGTTGGAAAGGGAAGAGGCTAAATCATAAAGTATTATTTGGATGCTTTAAAAGCTAAAAG
CCAAGGAAACAACATGGAAATAGAGGATAAGCAAAAAAATAAAAAATAAAATGAAATATT
CTGCTTAATCCGTAATCCTACTTCAAGAAAGTACTATTTGGCAAACCTTTATTTAATTTG
A