Identifiers and Description

Gene Model Identifier

TTHERM_00312730

Standard Name

POM121

Aliases

PreTt03460 | 30.m00269 | 3810.m01882

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 80%

TetraMine Data

TTHERM_00312730

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03287.19.997093137033517e-262hypothetical protein (1181 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:28386019: Iwamoto M, Osakada H, Mori C, Fukuda Y, Nagao K, Obuse C, Hiraoka Y, Haraguchi T (2017) Compositionally distinct nuclear pore complexes of functionally distinct dimorphic nuclei in the ciliate Tetrahymena. Journal of cell science 130(10):1822-1834

Sequences

>TTHERM_00312730(coding)
ATGGAAAATTAGCAAGTACTTTCTCTTTTGCTTTTCTTCCTTTAGATAATTATTGCCTTG
AAGACTTTGCATGCGTTGAATAATCATGAGGAAGATAAAGAAAAGAAGAATTAATCAAGC
AAAAATCAAGATGCATAAAATAAGGATAAGGAATAAACAGTAGATCAAACAACTAAAAAT
TAGCATTAAATTGCATCGTAGTAATATCTTGCTAATTAAAGTAACAAAGATTAGCATTTG
TCTTCTCAGTTTTATGGAAATTAGACAAGCAGTGGACCATCATTTAGCAATTTCGATATA
GATGTCTCAACTACATAGAGACAGCGTACTGATTCCTTCAGTGTACCAAACCCAAGTAGT
TAAATTATTCAAAATTAATTGAAATTGAAAACTACTGTCAACATAAAAGATTTGCAACCT
TACATAAATGATAATTACTTATAAACTCCTAACTTTAATACTAAAAATAATATTGTAGGC
TAAAATAAGAGCAGAAAGAACTCAGAAAATATACCCTAAACTCCTAATTTCCAGCCAGAA
AAAAGCAAAAAATTATAGCTTAATTTATAAACAAATAGTTATTAGAATCCAAAAAAGATA
GCATCTAGTAACAACCAAGATTTTAATTTGAATTAGCAAAACAATTCTATGATGGAAGTT
AATTATGATTTGGACCAAGAAAGTCAAGAAATGCATTAGGAAGAGCTTCCTCAGCCTCCC
TAATTTAAAACTGGTATGAGTATTAAGGAAATTATGAAAGTAGAAACTCCAGAAAAGAAA
AAGATTTTGCAATAAAACAAAATGTTGTTCCAAGACAATAGCATCAACAATAATATAAGT
CCCTTCATAAATCCTAAAAATTTCGTTTAATCTCCTGACTCTAACTTTTATACTCGTTAA
AACAGATAAAGTAGTGTCTAAGAAGACAAAAGAAATAAACACCATTTTATAAATTAAAGC
TAAATTCTTAAGGAAAAAGAAGCAAAAGTTATTAAAAATGATGAAAAAATCAGAGATGCA
CATTGGATTTAGCCTCCTACAAGCAAACCTTCAAGAAAGTATTAAGAAAAAAGAGACTAA
AACTTAAGTCAATAATACAGAGATATTCCTAACCCTAGCTTTGATGATAGAGCAGAACAA
TTAGATTCCAAGGTTATTTCTCGTAAAAGGCATGTATTCGATAGCTTTGCTCATGCTTAT
GAATCCGATGATATGGAAGATGAATAAACTGAAAAGAACCATTCTATTTGCAAAATTTTA
CAAGTTCAAAAGAAAAGAAAGGAGGAACTTTTTTCTAAGTTTATCAAGTAAAAAGAAGCA
GAAAAAAAGAACTAAATTTTGTTTAATGCTCCTTATAGCAATAACATGAATACTTTAGTT
ACGATAAATCACCGTGAATAGGAAAAGATTGACCTTGAGGAAGCTGCTAAAGTAGAAAAA
CCAATTTTTATAAAGCCAGCTGATAGTTTGATATTAAACAAGAATGATAATCTACCTTAA
TAGCCATCTGAAAGCAATTTTAAATTGCCAGGAAATGAAAATACAAGTTTATTCAGTTAA
AACTAAACTAAGCCTGCATCTATAAATATTATCATTCCTGATAAACAAATTTAAGCCAAC
TAAGATGAAAAAAGTACTCCTCTTGATAAAAAAGACGAAGGCATTAAATTATCTGTTTTA
AATCCTCCTCCTGCTCCAAAGGCTGCATAAGCAGCTCCTTTGGGATTATTTGCTAACTTA
CCTCAATCATCTTTAGTATCAGTAGATAAGAAAGAAGATAATAACACTGCTGTTTAGGCA
GTTAAGTCTACACCTCTTTTTAACTTATAAGAATCAAGTGCTGAAAGTCTAAAAAAATCT
GATGGAATCAAAGAAATCTAAGAAAGCTCTTAAGAAAAAAATTTAACTACTCCTCAATAA
ACAATTACAAGTAGCAGTTAAGTTATTTCTAATCCATTTGATTCTTAATAATCTCTTTTC
AGCAAAAGTCAAACTCCATAGCAAGCTTAAACTCCTTAATAACTTTAAACTCAAATAGAA
ATTTAAAACGAAATAGCACAAAAAAAAGGTTTACCCAAAAAGTAAACCAGTGCTGGTGGT
CTCTTTGGAAACTTAGCTTCAGCTTAGACAGAATAAAAAAAAGATGATGTAGGGCAACCT
ATGCAAACTAATACAGGATTATAAATACCCTCTATTCAAGCAAGTATAGGAATAGCTTAA
CCACTCACTCCAGCAAACACAGGATTCTTATTTAACATGCCAAAATAGTAGTAATAGCAA
TAATAAAATATTGGAACCCAAGCATCTAATAATGTAACTGAGAGAAATATATCTTCTTTT
GACAAGTCAATCGAACCTTAAAAAGCTCTTCCTCCTAAAAATAAAGAATAAACTCAACCT
GAAAATAAGTTCGGTGGTGAAGGTGGTTTATTTGGAAATTTAGGTAAAAATTAGATTTCT
TTAGACTAGTCAGTTAAAGTAACCACAACTTTGACAAATGAAGTAAAAGAAGTTTAGGCT
GCAGAAACAATGCAAACTACAACTTAAGATAATTCTGCTTCTGAACTTTTTAAAACACCA
TTTAGTTTGGATTCATAGAGTTAAGTTTAACAGTAAGCAAAAAATATTACAGATTAAAAG
AATGATAATCATAAAGTTCCAACTCCTGTTTAACCTTAACCTTAACCTTAATCTTAAGGA
TTGTTTGGAAATTTAAGTAGTAATTAATCTGTTACTGAATAGAAGAACTTTTTGAATTAA
CCAAATATCCCAAGTAGTTTATTCCCTAGCGTTTCTAATAGCAATGGATTAAACCAAGGA
GGAGGTTTATTTGGAAAGAAAGATGAAAATACTTAATAGCAAATTGCAGAAAAGAAAACT
GAATAACCTAAAAACTTATTTAGTGGATTAATTAAAGATGGCGCTGTAGGTGGAGAATAA
GCAATAGGAGGCTTTTTAAAGCAAGAAGCAAATAATAAATCAAACGGATTAGGATCAGGA
TTAGCATTTTTATAAAACCCAGGTGATGATAAACCGAAAGAAGCTAAAAATTTATTTGGA
TAATCCATATCTAATATAAATCAAAGTGGAGGTATTTTTGATAAATCCAATAACAACCCT
TTAAAAGACAAATAATAATAGTAATAGTAGTTGAATAAGGACTTTGAGCCTTTACCACAA
AAAGCTATCAATTAAGAAAATGGTTAACTTTAAACAGAAGTAAATGGTTTAAACTCTTTA
GATAAGTAATAGAACTAACCAGTAAGCTAAAGTTTATTTACACCTTCATCTTAACCAGTT
TAAAATTCTTTATTCTAATTGAAAGAATAACCTAAAGTATCCACTTCTTAATTGTAAAGT
AGTTCGTAAGGAGGTTTATTTGGAAGTTAAAATTAATCATTAAGTCAATAAACCAATTAA
TCAGAACCTAACAAAAATACATCCTTATTTGGTAATTTATAAAGTTAAAATAAAGGGGGC
TTATTTGGCTCTAATGGAACAGGACTTTTTGCAAATTAATCTAGCAATTCTAATTAGTAA
AATGGTTTATTTGGAAATACTAGCCTATTTTCAAAACCAGCAGAGAGTGCTACATAATGA


>TTHERM_00312730(protein)
MENQQVLSLLLFFLQIIIALKTLHALNNHEEDKEKKNQSSKNQDAQNKDKEQTVDQTTKN
QHQIASQQYLANQSNKDQHLSSQFYGNQTSSGPSFSNFDIDVSTTQRQRTDSFSVPNPSS
QIIQNQLKLKTTVNIKDLQPYINDNYLQTPNFNTKNNIVGQNKSRKNSENIPQTPNFQPE
KSKKLQLNLQTNSYQNPKKIASSNNQDFNLNQQNNSMMEVNYDLDQESQEMHQEELPQPP
QFKTGMSIKEIMKVETPEKKKILQQNKMLFQDNSINNNISPFINPKNFVQSPDSNFYTRQ
NRQSSVQEDKRNKHHFINQSQILKEKEAKVIKNDEKIRDAHWIQPPTSKPSRKYQEKRDQ
NLSQQYRDIPNPSFDDRAEQLDSKVISRKRHVFDSFAHAYESDDMEDEQTEKNHSICKIL
QVQKKRKEELFSKFIKQKEAEKKNQILFNAPYSNNMNTLVTINHREQEKIDLEEAAKVEK
PIFIKPADSLILNKNDNLPQQPSESNFKLPGNENTSLFSQNQTKPASINIIIPDKQIQAN
QDEKSTPLDKKDEGIKLSVLNPPPAPKAAQAAPLGLFANLPQSSLVSVDKKEDNNTAVQA
VKSTPLFNLQESSAESLKKSDGIKEIQESSQEKNLTTPQQTITSSSQVISNPFDSQQSLF
SKSQTPQQAQTPQQLQTQIEIQNEIAQKKGLPKKQTSAGGLFGNLASAQTEQKKDDVGQP
MQTNTGLQIPSIQASIGIAQPLTPANTGFLFNMPKQQQQQQQNIGTQASNNVTERNISSF
DKSIEPQKALPPKNKEQTQPENKFGGEGGLFGNLGKNQISLDQSVKVTTTLTNEVKEVQA
AETMQTTTQDNSASELFKTPFSLDSQSQVQQQAKNITDQKNDNHKVPTPVQPQPQPQSQG
LFGNLSSNQSVTEQKNFLNQPNIPSSLFPSVSNSNGLNQGGGLFGKKDENTQQQIAEKKT
EQPKNLFSGLIKDGAVGGEQAIGGFLKQEANNKSNGLGSGLAFLQNPGDDKPKEAKNLFG
QSISNINQSGGIFDKSNNNPLKDKQQQQQQLNKDFEPLPQKAINQENGQLQTEVNGLNSL
DKQQNQPVSQSLFTPSSQPVQNSLFQLKEQPKVSTSQLQSSSQGGLFGSQNQSLSQQTNQ
SEPNKNTSLFGNLQSQNKGGLFGSNGTGLFANQSSNSNQQNGLFGNTSLFSKPAESATQ


>TTHERM_00312730(gene)
ATTGAAAATAAAATAAAGTAAATTAATTATAAATCAAGGCGCAAGCAGGAAATATAAAAA
ATAAATTAATAAATAAATATTTTTCAGAAAAAAGAATACAAAGTAGAAGGCAACTTTTGT
AAAGATAAAAAAATATTAAGTAGAAAACAAAAAATATAAAAAGAAATAAACAATAGAAAA
GCAGAAATATTCATTAAAGCAGGGAATTTAAAAATGGAAAATTAGCAAGTACTTTCTCTT
TTGCTTTTCTTCCTTTAGATAATTATTGCCTTGAAGACTTTGCATGCGTATTAATTAATT
TTTAATTCAACCGTTATAAGTGGCTTCAGCCCTTAAAATTTTCTATTGCTTAGTTAACTG
TTCTTAGATATAAAATTTGAATTTAACTATCAAATTATTTAGCTCAATGCAGATTAATTA
ATATTTGTTTTTTCGTAAATGGATAGGTTGAATAATCATGAGGAAGATAAAGAAAAGAAG
AATTAATCAAGCAAAAATCAAGATGCATAAAATAAGGATAAGGAATAAACAGTAGATCAA
ACAACTAAAAATTAGCATTAAATTGCATCGTAGTAATATCTTGCTAATTAAAGTAACAAA
GATTAGCATTTGTCTTCTCAGTTTTATGGAAATTAGACAAGCAGTGGACCATCATTTAGC
AATTTCGATATAGATGTCTCAACTACATAGAGACAGCGTACTGATTCCTTCAGTGTACCA
AACCCAAGTAGTTAAATTATTCAAAATTAATTGAAATTGAAAACTACTGTCAACATAAAA
GATTTGCAACCTTACATAAATGATAATTACTTATAAACTCCTAACTTTAATACTAAAAAT
AATATTGTAGGCTAAAATAAGAGCAGAAAGAACTCAGAAAATATACCCTAAACTCCTAAT
TTCCAGCCAGAAAAAAGCAAAAAATTATAGCTTAATTTATAAACAAATAGTTATTAGAAT
CCAAAAAAGATAGCATCTAGTAACAACCAAGATTTTAATTTGAATTAGCAAAACAATTCT
ATGATGGAAGTTAATTATGATTTGGACCAAGAAAGTCAAGAAATGCATTAGGAAGAGCTT
CCTCAGCCTCCCTAATTTAAAACTGGTATGAGTATTAAGGAAATTATGAAAGTAGAAACT
CCAGAAAAGAAAAAGATTTTGCAATAAAACAAAATGTTGTTCCAAGACAATAGCATCAAC
AATAATATAAGTCCCTTCATAAATCCTAAAAATTTCGTTTAATCTCCTGACTCTAACTTT
TATACTCGTAATTCTTCAAACTTTAAATATTATTAAGCAAACTAATTTTAAATATTATTA
AGCTAACTAATTTTAGTTATGTTTAAAAAAAGATTTATAATTCAACTAAATCTTTATTAT
AATATATAGGTTAAAACAGATAAAGTAGTGTCTAAGAAGACAAAAGAAATAAACACCATT
TTATAAATTAAAGCTAAATTCTTAAGGAAAAAGAAGCAAAAGTTATTAAAAATGATGAAA
AAATCAGAGATGCACATTGGATTTAGCCTCCTACAAGCAAACCTTCAAGAAAGTATTAAG
AAAAAAGAGACTAAAACTTAAGTCAATAATACAGAGATATTCCTAACCCTAGCTTTGATG
ATAGAGCAGAACAATTAGATTCCAAGGTTATTTCTCGTAAAAGGCATGTATTCGATAGCT
TTGCTCATGCTTATGAATCCGATGATATGGAAGATGAATAAACTGAAAAGAACCATTCTA
TTTGCAAGTAAATCTTTTTACATGAATTAATTATTTAATTAGTTGGATAATTTATTGGGA
AAAAAAAAATAAATGTTTTATATTTGTTAATAAATATCTTAAAAATTAGCTAAATAATAA
TAAATATTTGTATTAATACTTGTTTATTTATTCATAATTTAAATAATAGAATTTTACAAG
TTCAAAAGAAAAGAAAGGAGGAACTTTTTTCTAAGTTTATCAAGTAAAAAGAAGCAGAAA
AAAAGAACTAAATTTTGTTTAATGCTCCTTATAGCAATAACATGAATACTTTAGTTACGA
TAAATCACCGTGAATAGGAAAAGATTGACCTTGAGGAAGCTGCTAAAGTAGAAAAACCAA
TTTTTATAAAGCCAGCTGATAGTTTGATATTAAACAAGAATGATAATCTACCTTAATAGC
CATCTGAAAGCAATTTTAAATTGCCAGGAAATGAAAATACAAGTTTATTCAGTTAAAACT
AAACTAAGCCTGCATCTATAAATATTATCATTCCTGATAAACAAATTTAAGCCAACTAAG
ATGAAAAAAGTACTCCTCTTGATAAAAAAGACGAAGGCATTAAATTATCTGTTTTAAATC
CTCCTCCTGCTCCAAAGGCTGCATAAGCAGCTCCTTTGGGATTATTTGCTAACTTACCTC
AATCATCTTTAGTATCAGTAGATAAGAAAGAAGATAATAACACTGCTGTTTAGGCAGTTA
AGTCTACACCTCTTTTTAACTTATAAGAATCAAGTGCTGAAAGTCTAAAAAAATCTGATG
GAATCAAAGAAATCTAAGAAAGCTCTTAAGAAAAAAATTTAACTACTCCTCAATAAACAA
TTACAAGTAGCAGTTAAGTTATTTCTAATCCATTTGATTCTTAATAATCTCTTTTCAGCA
AAAGTCAAACTCCATAGCAAGCTTAAACTCCTTAATAACTTTAAACTCAAATAGAAATTT
AAAACGAAATAGCACAAAAAAAAGGTTTACCCAAAAAGTAAACCAGTGCTGGTGGTCTCT
TTGGAAACTTAGCTTCAGCTTAGACAGAATAAAAAAAAGATGATGTAGGGCAACCTATGC
AAACTAATACAGGATTATAAATACCCTCTATTCAAGCAAGTATAGGAATAGCTTAACCAC
TCACTCCAGCAAACACAGGATTCTTATTTAACATGCCAAAATAGTAGTAATAGCAATAAT
AAAATATTGGAACCCAAGCATCTAATAATGTAACTGAGAGAAATATATCTTCTTTTGACA
AGTCAATCGAACCTTAAAAAGCTCTTCCTCCTAAAAATAAAGAATAAACTCAACCTGAAA
ATAAGTTCGGTGGTGAAGGTGGTTTATTTGGAAATTTAGGTAAAAATTAGATTTCTTTAG
ACTAGTCAGTTAAAGTAACCACAACTTTGACAAATGAAGTAAAAGAAGTTTAGGCTGCAG
AAACAATGCAAACTACAACTTAAGATAATTCTGCTTCTGAACTTTTTAAAACACCATTTA
GTTTGGATTCATAGAGTTAAGTTTAACAGTAAGCAAAAAATATTACAGATTAAAAGAATG
ATAATCATAAAGTTCCAACTCCTGTTTAACCTTAACCTTAACCTTAATCTTAAGGATTGT
TTGGAAATTTAAGTAGTAATTAATCTGTTACTGAATAGAAGAACTTTTTGAATTAACCAA
ATATCCCAAGTAGTTTATTCCCTAGCGTTTCTAATAGCAATGGATTAAACCAAGGAGGAG
GTTTATTTGGAAAGAAAGATGAAAATACTTAATAGCAAATTGCAGAAAAGAAAACTGAAT
AACCTAAAAACTTATTTAGTGGATTAATTAAAGATGGCGCTGTAGGTGGAGAATAAGCAA
TAGGAGGCTTTTTAAAGCAAGAAGCAAATAATAAATCAAACGGATTAGGATCAGGATTAG
CATTTTTATAAAACCCAGGTGATGATAAACCGAAAGAAGCTAAAAATTTATTTGGATAAT
CCATATCTAATATAAATCAAAGTGGAGGTATTTTTGATAAATCCAATAACAACCCTTTAA
AAGACAAATAATAATAGTAATAGTAGTTGAATAAGGACTTTGAGCCTTTACCACAAAAAG
CTATCAATTAAGAAAATGGTTAACTTTAAACAGAAGTAAATGGTTTAAACTCTTTAGATA
AGTAATAGAACTAACCAGTAAGCTAAAGTTTATTTACACCTTCATCTTAACCAGTTTAAA
ATTCTTTATTCTAATTGAAAGAATAACCTAAAGTATCCACTTCTTAATTGTAAAGTAGTT
CGTAAGGAGGTTTATTTGGAAGTTAAAATTAATCATTAAGTCAATAAACCAATTAATCAG
AACCTAACAAAAATACATCCTTATTTGGTAATTTATAAAGTTAAAATAAAGGGGGCTTAT
TTGGCTCTAATGGAACAGGACTTTTTGCAAATTAATCTAGCAATTCTAATTAGTAAAATG
GTTTATTTGGAAATACTAGCCTATTTTCAAAACCAGCAGAGAGTGCTACATAATGA