Identifiers and Description

Gene Model Identifier

TTHERM_00043780

Standard Name

POLN1 (putative homolog to POLN)

Aliases

PreTt11055 | 3.m01785 | 3824.m02818

Description

DNA polymerase I family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00043780

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01875.19.997093137033517e-262DNA polymerase I family protei
n (970 aa)
OxytrichaContig21740.0.g89.997093137033517e-262DNA polymerase family A
DictyBaseDDB_G02674641.0002534232488231e-144polA on chromosome: 1 position
1469084 to 1473264
WormBaseWBGene000209649.004486704249587e-32locus:polq-1 status:Partiall
y_confirmed UniProt:A0FLQ6
protein_id:CCD73325.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00043780(coding)
ATGATAACTTTCTTGAAGAGATTAACCAACAAAAATACATAAATCAATCAACCAGTTTTT
AGATTTTGTTCTGCTAACCCAAGCAACTCTCAAGTTTTAGGAGACTATGTAATCAAATCT
AAAATGAGTGGACACTCTTCTGAAAATTTATATGAGAAATATAAAAATTTTTACAATGTT
CAAATAGAAAAAATCAACATTCCTGGAACAACTATTGTAAAAAATAGAGACTAGGCTCAC
AAGGTTGTAAAAATCTTAAAAAGCTTACCAAACAGAGAGCATGCATGGGATACAGAAACT
ATAGATGTAGATGCTAAATTAGAATCTCCTATTGGAAAAGGAAAAATTATCTGCGCTTCA
GCCTTTTGTGGAATTGATGTAGATTTTGGAAATGGTCCAAGGTTGTTTATAGATAATTTT
GCTCAAAACACTGACTTGATTTAAATTTTTAAAGAGTATTTAGAAGATTCTAGATACAAA
AAGATTTGGCATAATTATGGATTTGATCGTCATATTTTTTATAATCATGGTATTAATGTC
TAAGGATTTGGAGGTGATACTATGCACTTGGCAAGATTAGCAGATCCAAGTAGAGGACCA
AAAGAATATAGTTTAGCAAATGTAACCAAGCATTATGAAGAAGAAATAAAATATTTAAAG
AGATAATTAATTAATGATCTGAGAAAAAGCATTTAAATTAATACATAAGAACTTCAAAGT
GTTTTAGCAGCACTTTAAAAAGGAGCAGATTTACCTCATGAAATTATTTAAAAATTCAAA
CTTCATAGATTTAATACAAGAGATGAATAAATATTCTTTATAAATGATCAAATACAAAAG
TGGTTGATCAAAAAATAGCCTGCTGATTAATATGAAAAATACTACTTAAATACAAACTTA
AAAACAAATATGAAACAACTCTTTGGTAAAAAGAAATACTTAAAAGATGGAAAAGAAGGA
AAAACTATTGAATTCCCAAATACTATTCGTATGCACACAGATCCAGAACTTCTAGAAAAA
TGGGTTCATTACTCATGTTTGGATGCTGAAATCACCTTCTTTGTTTTTTAAGTATTAAAA
GACGAATTAAAAAGTTTAAGCACCAACTTCGAAGACATGAAAAATATGTTAGATTTATAC
AACAAGTACTGGAAACCTTTTGGAGAAATATTAACTGATTTAGAAAGAAGAGGCTTTGAG
CTAAATTTGGAACATTTGGATAAAATTAGAGTTTAAGCTGAGAATGATATGATTAAATTG
GAAAAACAATTCTTAGATTGGGTATGCTCTACTCAATAAGGATTAGAATAATTTAATTAT
TCCTCTGCTCAGTAGCTTCAATAATTATTTTTTGCACCTTTCAAGAGAAAGAAAAGAATT
ACTAAGGATAAAGTCGATGCTAACTTGGATGATAAAGAAAAAAAAGATCTTGAAGGATTT
AAAAGTTTTGAAGAGAATAGTGCTGCTATTGATGATGACGAACAGTTTTTCAAATAATAA
TTTAATGAACAAAATGAAGATTTGGATGAAGACGAAGATGATGATGAGCCATAAAAAAAT
AAAAGGCTTTTCAAAAAAGCAAAGCCACAAGAAGATGATGACGATGGCTACCTTTCAGAT
GGTCGTAAGAAATCAGTCCGTAAAGAGGAAGATGATATCCCTTAGACAAAAGCCTTTAAA
GTCCTAAACATAAAGGGAATAATCCCAGAAGGAAAGAAAAAACCCCCAAAACAACTAGAT
ATGAATATCACAGGGCTCGGCCTAGAAGTAATTAGTCTTACTGACTCTGGAATGCCTGCA
GCCGATCTTCCAGTTTTAAAAATCTTAGCAGGAAACCCAAAAAAAGGAAATTATGGTGCA
ATAGGCGAATATTACAAACAAAAAGGAGATGAAGAAATGGGAAAAAGGGCTTCTCATGCT
ATTGAGTCTTTAATTTAACTTAAATAGGTAGAAACTCTTTTAACAACTTTTATTATTCCA
CTGAGAGAATTAGCAGATAAAGATGGAAGAATACACTGTTCACTGAATATGAATACTGAA
ACAGGAAGAATATCAGCAAGAAAACCTAATTTAATGAATTAACCCTCACATGATAAAGAT
GTGTATAAAATTCGTAGTGCTTTCTAAGCTGGTAAAGGTAACAAGCTTATTGTGGCTGAT
TATGGTCAATTAGAACTTAGAATTCTTGCTCATATGACAAATTGTAAGGCAATGATTGAA
GCCTTTAAAATGGGTGGTGATTTTCACAGTAGAACTGCTATGGGTATGTACCCTAAGCTA
AAGGAGGAAATAGAAAAGGGTGAGCTACTTTTAGAATGGGATAAATCTCAAGGAGAACCC
CCTGCACCGTTACTCAAAGATAAGTACTCAAGTGAAAGAAAAAAAGCTAAGATGATGAAT
TTCTCAATAGCATATGGAAAGAGTGCACATGGCTTTTCTAAAGATTGGAACTGCTCTATG
AAAGAAGCATAAGAAGCTCTAGATGCTTGGTTTGCAGACAGAAAGGAAGTAAAAGAATGG
CAAGAAAACACTAAAAAAATAGCCCTAGAACATGGATACACATAGACAATGATGGGAAGA
TATAGAAATTTAGAAAGGCTTACTCATTCAAAGAGTGCTAGACATCTTGTTTAACATGGT
TTAAGAGCCTCTATAAATACCCCAATTTAAGGTGGTGCAGCAGATTTAGTTATTGCTGCA
ATGGTAAAAGTATCATAAGACCCTAAGCTTAATGAGCTAGGCTACAAGCTATTGCTATAA
ATTCATGATGAATTAATCTTAGAAGGACCGGAAGAGCATGCTTAAGAAGCATTAGCAAGA
GTTATAGAAATAATGGAAAATCCCTTAGATACCCCATTATTGCTAAAGATGGAAGTAGAC
GCTAAAGTTGGTAATAATTGGTATGAGTGTAAATGA


>TTHERM_00043780(protein)
MITFLKRLTNKNTQINQPVFRFCSANPSNSQVLGDYVIKSKMSGHSSENLYEKYKNFYNV
QIEKINIPGTTIVKNRDQAHKVVKILKSLPNREHAWDTETIDVDAKLESPIGKGKIICAS
AFCGIDVDFGNGPRLFIDNFAQNTDLIQIFKEYLEDSRYKKIWHNYGFDRHIFYNHGINV
QGFGGDTMHLARLADPSRGPKEYSLANVTKHYEEEIKYLKRQLINDLRKSIQINTQELQS
VLAALQKGADLPHEIIQKFKLHRFNTRDEQIFFINDQIQKWLIKKQPADQYEKYYLNTNL
KTNMKQLFGKKKYLKDGKEGKTIEFPNTIRMHTDPELLEKWVHYSCLDAEITFFVFQVLK
DELKSLSTNFEDMKNMLDLYNKYWKPFGEILTDLERRGFELNLEHLDKIRVQAENDMIKL
EKQFLDWVCSTQQGLEQFNYSSAQQLQQLFFAPFKRKKRITKDKVDANLDDKEKKDLEGF
KSFEENSAAIDDDEQFFKQQFNEQNEDLDEDEDDDEPQKNKRLFKKAKPQEDDDDGYLSD
GRKKSVRKEEDDIPQTKAFKVLNIKGIIPEGKKKPPKQLDMNITGLGLEVISLTDSGMPA
ADLPVLKILAGNPKKGNYGAIGEYYKQKGDEEMGKRASHAIESLIQLKQVETLLTTFIIP
LRELADKDGRIHCSLNMNTETGRISARKPNLMNQPSHDKDVYKIRSAFQAGKGNKLIVAD
YGQLELRILAHMTNCKAMIEAFKMGGDFHSRTAMGMYPKLKEEIEKGELLLEWDKSQGEP
PAPLLKDKYSSERKKAKMMNFSIAYGKSAHGFSKDWNCSMKEAQEALDAWFADRKEVKEW
QENTKKIALEHGYTQTMMGRYRNLERLTHSKSARHLVQHGLRASINTPIQGGAADLVIAA
MVKVSQDPKLNELGYKLLLQIHDELILEGPEEHAQEALARVIEIMENPLDTPLLLKMEVD
AKVGNNWYECK


>TTHERM_00043780(gene)
ATGATAACTTTCTTGAAGAGATTAACCAACAAAAATACATAAATCAATCAACCAGTTTTT
AGATTTTGTTCTGCTAACCCAAGCAACTCTCAAGTTTTAGGAGACTATGTAATCAAATCT
AAAATGAGTGGACACTCTTCTGAAAATTTATATGAGAAATATAAAAATTTTTACAATGTT
CAAATAGAAAAAATCAACATTCCTGGAACAACTATTGTAAAAAATAGAGACTAGGCTCAC
AAGGTTGTAAAAATCTTAAAAAGCTTACCAAACAGGTAAAATATGATCAAAATAATTTTT
AATTAAATGGTTAATTAATGATATAGAGAGCATGCATGGGATACAGAAACTATAGATGTA
GATGCTAAATTAGAATCTCCTATTGGAAAAGGAAAAATTATCTGCGCTTCAGCCTTTTGT
GGAATTGATGTAGATTTTGGAAATGGTCCAAGTATATTAAAAGAGTTTTTTTAGTTTAAC
AAAATTCAAAATAAATATAAATGATAACGTATTTATTTATTAATTCACTATATTTTATAA
CAATAGGGTTGTTTATAGATAATTTTGCTCAAAACACTGACTTGATTTAAATTTTTAAAG
AGTATTTAGAAGATTCTAGATACAAAAAGATTTGGCATAATTATGGATTTGATCGTCATA
TTTTTTATAATCATGGTATTAATGTCTAAGGATTTGGAGGTGATACTATGCACTTGGCAA
GATTAGCAGATCCAAGTAGAGGACCAAAAGAATATAGTTTAGCAAATGTAACCAAGCATT
ATGAAGAAGAAATAAAATATTTAAAGAGATAATTAATTAATGATCTGAGAAAAAGCATTT
AAATTAATACATAAGAACTTCAAAGTGTTTTAGCAGCACTTTAAAAAGGAGCAGATTTAC
CTCATGAAATTATTTAAAAATTCAAACTTCATAGATTTAATACAAGAGATGAATAAATAT
TCTTTATAAATGATCAAATACAAAAGTGGTTGATCAAAAAATAGCCTGCTGATTAATATG
AAAAATACTACTTAAATACAAACTTAAAAACAAATATGAAACAACTCTTTGGTAAAAAGA
AATACTTAAAAGATGGAAAAGAAGGAAAAACTATTGAATTCCCAAATACTATTCGTATGC
ACACAGATCCAGAACTTCTAGAAAAATGGGTTCATTACTCATGTTTGGATGCTGAAATCA
CCTTCTTTGTTTTTTAAGTATTAAAAGACGAATTAAAAAGTTTAAGCACCAACTTCGAAG
ACATGAAAAATATGTTAGATTTATACAACAAGTACTGGAAACCTTTTGGAGAAATATTAA
CTGATTTAGAAAGAAGAGGCTTTGAGCTAAATTTGGAACATTTGGATGTAACATATTCTT
TTAATTGATTATTTTTTTTAAAGTATTAAATATAGAAAATTAGAGTTTAAGCTGAGAATG
ATATGATTAAATTGGAAAAACAATTCTTAGATTGGGTATGCTCTACTCAATAAGGATTAG
AATAATTTAATTATTCCTCTGCTCAGTAGCTTCAATAATTATTTTTTGCACCTTTCAAGA
GAAAGAAAAGAATTACTAAGGATAAAGTCGATGCTAACTTGGATGATAAAGAAAAAAAAG
ATCTTGAAGGATTTAAAAGTTTTGAAGAGAATAGTGCTGCTATTGATGATGACGAACAGT
TTTTCAAATAATAATTTAATGAACAAAATGAAGATTTGGATGAAGACGAAGATGATGATG
AGCCATAAAAAAATAAAAGGCTTTTCAAAAAAGCAAAGCCACAAGAAGATGATGACGATG
GCTACCTTTCAGATGGTCGTAAGAAATCAGTCCGTAAAGAGGAAGATGATATCCCTTAGA
CAAAAGCCTTTAAAGTCCTAAACATAAAGGTATTAAAATATATATTTACTTCTTAAATAA
TTTATATTTAAACTGTATATTTTTAAATACAGGGAATAATCCCAGAAGGAAAGAAAAAAC
CCCCAAAACAACTAGATATGAATATCACAGGGCTCGGCCTAGAAGTAATTAGTCTTACTG
ACTCTGGAATGCCTGCAGCCGATCTTCCAGTTTTAAAAATCTTAGCAGGAAACCCAAAAA
AAGGAAATTATGGTGCAATAGGTAAATTGTTGAAAAATAATTAATTAGCAGCTAAAGTAT
ACAATTAAATAGGCGAATATTACAAACAAAAAGGAGATGAAGAAATGGGAAAAAGGGCTT
CTCATGCTATTGAGTCTTTAATTTAACTTAAATAGGTAGAAACTCTTTTAACAACTTTTA
TTATTCCACTGAGAGAATTAGCAGATAAAGATGGAAGAATACACTGTTCACTGAATATGA
ATACTGAAACAGGAAGAATATCAGCAAGAAAACCTAATTTAATGAATTAACCCTCACATG
ATAAAGATGTGTATAAAATTCGTAGTGCTTTCTAAGCTGGTAAAGGTAACAAGCTTATTG
TGGCTGATTATGGTCAATTAGAACTTAGAATTCTTGCTCATATGACAAATTGTAAGGCAA
TGATTGAAGCCTTTAAAATGGGTAAAATTTTATCTTGTAAAAACAAAAGATAAAAAATTT
TTTTTTATTAAATAGGTGGTGATTTTCACAGTAGAACTGCTATGGGTATGTACCCTAAGC
TAAAGGAGGAAATAGAAAAGGGTGAGCTACTTTTAGAATGGGATAAATCTCAAGGAGAAC
CCCCTGCACCGTTACTCAAAGATAAGTACTCAAGTGAAAGAAAAAAAGCTAAGATGATGA
ATTTCTCAATAGCATATGGAAAGAGTGCACATGGCTTTTCTAAAGATTGGAACTGCTCTA
TGAAAGAAGCATAAGAAGCTCTAGATGCTTGGTTTGCAGACAGAAAGGAAGTAAAAGAAT
GGCAAGAAAACACTAAAAAAATAGCCCTAGAACATGGATACACATAGACAATGATGGGAA
GATATAGAAATTTAGAAAGGCTTACTCATTCAAAGAGTGCTAGACATCTTGTTTAACATG
GTTTAAGAGCCTCTATAAATACCCCAATTTAAGGTGGTGCAGCAGATTTAGTTATTGCTG
CAATGGTAAAAGTATCATAAGACCCTAAGCTTAATGAGCTAGGCTACAAGCTATTGCTAT
AAATTCATGATGAATTAATCTTAGTATTTTAAAAAAATTTATTTATCATTTAATTTTAAC
TAATGATAATAAAATAGGAAGGACCGGAAGAGCATGCTTAAGAAGCATTAGCAAGAGTTA
TAGAAATAATGGAAAATCCCTTAGATACCCCATTATTGCTAAAGATGGAAGTAGACGCTA
AAGTTGGTAATAATTGGTATGAGTGTAAATGA