Identifiers and Description

Gene Model Identifier

TTHERM_00455309

Standard Name

POLK1 (DNA polymerase kappa )

Aliases

3712.m00915

Description

DNA polymerase IV / kappa; homolog to human POLK

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00455309

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13728.19.997093137033517e-262DNA polymerase IV/kappa (885 a
a)
OxytrichaContig2834.0.g885.999773492405769e-126impB/mucB/samB family
WormBaseWBGene000176961.0002223712504345e-79locus:polk-1 DNA polymerase
kappa status:Confirmed Uni
Prot:P34409 protein_id:CCD62
142.1
DictyBaseDDB_G02871496.002524403568988e-55DDB_G0287149 on chromosome: 4
position 5382189 to 5383827
Stentor CoeruleusSteCoe_110049.221146422925876e-47
SGDYOR346W0.000000000000006000101554955223REV1 Deoxycytidyl transferase;
involved in repair of abasic
sites and adducted guanines in
damaged DNA by translesion sy
nthesis (TLS); forms a complex
with the subunits of DNA poly
merase zeta, Rev3p and Rev7p;

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00455309(protein)
MSQSQHNLEENQQQKGEVQYLFVGNKAGLDNVDKEKINKIINETTQSSEFYKRQQVKRDQ
YDERIKEMKLIIEQTKQDHIKLLKVKKECEDKLDQIKQLVQLDRIWVHFDMDMFYVACEL
KDRPQLKDLPVAVGGMSMISTANYVARKFGVRSAMPGFIAKKLCPQLILIPCNFEKYRKA
SDQFKKVLYQYDPNLESMGLDEANLDITDYLQQNNINSDAQIYDLCHSIRNQVFESTGGL
TCSCGIGPNKMLAKICSDMNKPNGQFQLINDEEKIKDFMKDLPIRKIPGIGNVTEQILKG
IGIEKCSQILERVIDIKICFKDLSFDHLVSSALGIGRSWHEEETEKKSLSVSRTFQAIST
IEEINEKIHQISQLLAEDAKAEQKIGKHLAVSFKNVKFQMRSKNRMLDKYIQDSEQIEKV
AKELVKELLPTEPLRLIGIRLSQLADENELKNQGLSKYFAKNDKSLNNSRIQSSSKSSKK
SFDNKNQNSLTTYFSNQEKNNSSLNVYQNQKIKGLLNDKNLGDVSNHQEASNFSINPNNL
QKSHSNNLIQPSFLSLIDKYESEDQEDENEDSFQENNSCNKLQKQTKHQESMLNEMSYSN
NQQQFQISKDNKQYINESDCESKNESEIDNRQKQEEYENDDDDDEDGDEDDDDDLIYLKK
ILNKNVSERLSQISEKKSQEEKRQSLSDKNNSMTPQFIQQSGGSQNQRNGSIQQKETQMI
PETAHQNKQFQSQQINQTQYYQRKSEKSEISFQQQSIQSQEYMHLMMGSEESSKLDIRIN
RNIFPNKVQNEKENSNSMYVYDENAEYMSQQYIEHNSGSQMNNKKRVPADALTPQQVEEQ
LKLKKKFIPRLFECPICFLQLDSYGNATFVNNHITNCMKAQEEKFNKLEQNNSQQNTQKE
EKKPVSILNNYTTKQDTKTKQSDKKNRKSDQKKQQKNSFTLDSFVIKQKN


>TTHERM_00455309(coding)
ATGTCTTAAAGCTAACATAATTTAGAAGAAAATCAATAGCAAAAAGGAGAGGTGCAATAC
CTTTTTGTGGGAAATAAAGCTGGTTTAGATAATGTAGATAAAGAAAAAATAAATAAAATT
ATTAATGAAACCACTTAATCAAGTGAATTTTATAAAAGATAGTAAGTGAAAAGGGATTAA
TATGATGAAAGGATTAAAGAAATGAAATTAATAATAGAACAAACCAAATAAGATCATATT
AAGCTTTTGAAAGTCAAGAAAGAATGTGAAGATAAATTAGATTAAATTAAATAATTAGTT
CAGCTTGATAGGATTTGGGTTCATTTTGATATGGATATGTTTTATGTTGCTTGCGAACTT
AAGGATAGACCTCAATTAAAAGATTTGCCAGTGGCTGTTGGTGGTATGTCAATGATTAGT
ACAGCTAATTATGTTGCTAGAAAATTTGGTGTAAGATCTGCTATGCCTGGTTTCATTGCT
AAAAAGCTATGTCCTTAATTAATTTTAATTCCTTGTAATTTTGAAAAATATAGAAAAGCA
AGTGATTAATTCAAAAAAGTCTTATACTAATATGATCCTAATTTAGAAAGCATGGGGCTA
GATGAGGCTAATCTGGATATAACAGATTATTTACAATAAAATAATATTAACTCAGATGCA
CAAATATACGATTTATGTCATTCTATTAGAAATCAGGTTTTTGAATCCACTGGAGGTCTA
ACTTGTTCTTGTGGTATTGGACCAAACAAAATGCTAGCTAAAATCTGCTCAGATATGAAT
AAGCCCAATGGTTAGTTTTAGTTGATAAATGATGAAGAAAAAATTAAGGATTTTATGAAA
GATTTGCCTATTAGAAAAATCCCTGGGATTGGGAATGTGACAGAATAAATCTTGAAAGGT
ATTGGAATAGAAAAATGTAGCTAAATCCTAGAAAGAGTTATTGATATAAAAATATGTTTT
AAAGATCTTTCTTTTGATCACTTAGTTTCTAGTGCTTTAGGTATAGGTCGTTCATGGCAT
GAAGAAGAGACGGAGAAAAAAAGTCTTTCAGTAAGTAGAACTTTTTAAGCAATATCAACT
ATAGAGGAAATAAACGAAAAAATACATTAAATTTCTCAGCTTTTAGCTGAAGATGCTAAA
GCAGAATAAAAAATTGGAAAGCATTTGGCTGTTTCTTTTAAAAATGTAAAATTTTAAATG
AGATCTAAAAACAGAATGCTTGATAAATATATTTAAGATAGTGAGTAAATTGAGAAAGTA
GCTAAGGAATTAGTTAAAGAATTATTACCTACTGAGCCTTTGAGGTTAATTGGAATTAGA
TTAAGTCAATTAGCTGATGAAAATGAGCTAAAAAACCAAGGATTGAGCAAATATTTTGCT
AAAAATGATAAAAGTTTAAACAATTCAAGAATTTAATCTTCAAGTAAGAGTTCTAAAAAA
TCATTTGACAATAAAAACCAAAATTCCTTGACAACTTATTTCAGTAATTAAGAAAAGAAT
AATTCAAGCTTAAATGTCTATTAAAATTAAAAAATAAAAGGACTTCTTAATGATAAAAAT
TTAGGAGACGTTTCTAATCATTAAGAAGCATCTAATTTCAGTATAAATCCAAATAATTTA
TAAAAGTCACATTCAAATAATTTAATTTAGCCCTCATTCCTAAGCTTAATAGATAAATAT
GAAAGTGAGGATCAAGAGGATGAAAACGAAGATTCTTTTTAAGAAAATAACTCATGTAAT
AAGTTATAAAAATAAACAAAACATTAAGAGAGTATGTTGAATGAAATGAGTTATAGTAAC
AATTAATAGTAATTCTAAATAAGTAAAGATAATAAGTAATATATAAATGAAAGTGATTGT
GAAAGTAAAAATGAAAGCGAAATAGACAACAGATAAAAATAAGAAGAATATGAAAATGAT
GATGATGACGATGAAGATGGAGACGAAGACGACGATGATGATTTAATTTACCTAAAAAAA
ATTTTAAATAAAAATGTTTCAGAAAGACTTTCTTAGATATCTGAAAAAAAAAGTTAAGAG
GAAAAAAGATAGTCATTATCAGATAAAAATAATTCTATGACACCTTAATTTATACAATAG
AGTGGAGGAAGTTAAAATTAAAGGAATGGCTCTATTTAACAAAAAGAAACATAAATGATA
CCTGAAACGGCTCACTAAAATAAACAATTTTAATCTTAGTAAATAAATTAGACTCAATAC
TATTAAAGAAAATCAGAAAAAAGTGAAATTAGCTTCTAGTAATAATCAATATAATCACAA
GAATATATGCATCTGATGATGGGTTCTGAAGAGTCCTCTAAGTTAGATATTAGAATAAAT
AGAAATATATTTCCTAATAAAGTGTAAAATGAAAAAGAAAATAGCAATTCCATGTATGTA
TATGATGAAAATGCTGAATATATGTCCTAACAATATATTGAGCATAATTCAGGATCATAA
ATGAATAATAAAAAGAGAGTTCCTGCTGATGCACTTACTCCACAATAGGTTGAAGAGCAG
TTAAAATTGAAAAAAAAATTTATTCCTAGGCTATTTGAATGTCCAATATGCTTTTTATAA
CTCGATTCTTATGGTAATGCTACATTTGTTAATAATCATATAACAAACTGTATGAAAGCC
TAAGAGGAGAAATTTAATAAGCTTGAATAAAATAATTCTTAATAAAATACATAGAAAGAA
GAAAAAAAACCAGTTTCTATATTAAATAATTATACCACAAAATAAGATACAAAGACAAAG
TAAAGTGATAAAAAAAATAGAAAGTCTGATTAAAAAAAATAGTAAAAAAACAGTTTTACA
TTAGATTCATTTGTAATAAAATAAAAAAATTGA


>TTHERM_00455309(gene)
ATGTCTTAAAGCTAACATAATTTAGAAGAAAATCAATAGCAAAAAGGAGAGGTGCAATAC
CTTTTTGTGGGAAATAAAGCTGGTTTAGATAATGTAGATAAAGAAAAAATAAATAAAATT
ATTAATGAAACCACTTAATCAAGTGAATTTTATAAAAGATAGTAAGTGAAAAGGGATTAA
TATGATGAAAGGATTAAAGAAATGAAATTAATAATAGAACAAACCAAATAAGATCATATT
AAGCTTTTGAAAGTCAAGAAAGAATGTGAAGATAAATTAGATTAAATTAAATAATTAGTT
CAGCTTGATAGGATTTGGGTTCATTTTGATATGGATATGTTTTATGTTGCTTGCGAACTT
AAGGATAGACCTCAATTAAAGTATTTTTAGCTTATAAAATAGTATTTACATTTTTATTTT
ATATTAATAGAGATTTGCCAGTGGCTGTTGGTGGTATGTCAATGATTAGTACAGCTAATT
ATGTTGCTAGAAAATTTGGTGTAAGATCTGCTATGCCTGGTTTCATTGCTAAAAAGCTAT
GTCCTTAATTAATTTTAATTCCTTGTAATTTTGAAAAATATAGAAAAGCAAGTGATTAAT
TCAAAAAAGTCTTATACTAATATGATCCTAATTTAGAAAGCATGGGGCTAGATGAGGCTA
ATCTGGATATAACAGATTATTTACAATAAAATAATATTAACTCAGATGCACAAATATACG
ATTTATGTCATTCTATTAGAAATCAGGTTTTTGAATCCACTGGAGGTCTAACTTGTTCTT
GTGGTATTGGACCAAACAAAATGCTAGCTAAAGTATGTTATAATTTAAGGAAAAAATTAT
TTATTGTTTGTTTTATAAATTTATTAGATCTGCTCAGATATGAATAAGCCCAATGGTTAG
TTTTAGTTGATAAATGATGAAGAAAAAATTAAGGATTTTATGAAAGATTTGCCTATTAGA
AAAATCCCTGGGATTGGGAATGTGACAGAATAAATCTTGAAAGGTATTGGAATAGAAAAA
TGTAGCTAAATCCTAGAAAGAGTTATTGATATAAAAATATGTTTTAAAGATCTTTCTTTT
GATCACTTAGTTTCTAGTGCTTTAGGTATAGGTCGTTCATGGCATGAAGAAGAGACGGAG
AAAAAAAGTCTTTCAGTAAGTAGAACTTTTTAAGCAATATCAACTATAGAGGAAATAAAC
GAAAAAATACATTAAATTTCTCAGCTTTTAGCTGAAGATGCTAAAGCAGAATAAAAAATT
GGAAAGCATTTGGCTGTTTCTTTTAAAAATGTAAAATTTTAAATGAGATCTAAAAACAGA
ATGCTTGATAAATATATTTAAGATAGTGAGTAAATTGAGAAAGTAGCTAAGGAATTAGTT
AAAGAATTATTACCTACTGAGCCTTTGAGGTTAATTGGAATTAGATTAAGTCAATTAGCT
GATGAAAATGAGCTAAAAAACCAAGGATTGAGCAAATATTTTGCTAAAAATGATAAAAGT
TTAAACAATTCAAGAATTTAATCTTCAAGTAAGAGTTCTAAAAAATCATTTGACAATAAA
AACCAAAATTCCTTGACAACTTATTTCAGTAATTAAGAAAAGAATAATTCAAGCTTAAAT
GTCTATTAAAATTAAAAAATAAAAGGACTTCTTAATGATAAAAATTTAGGAGACGTTTCT
AATCATTAAGAAGCATCTAATTTCAGTATAAATCCAAATAATTTATAAAAGTCACATTCA
AATAATTTAATTTAGCCCTCATTCCTAAGCTTAATAGATAAATATGAAAGTGAGGATCAA
GAGGATGAAAACGAAGATTCTTTTTAAGAAAATAACTCATGTAATAAGTTATAAAAATAA
ACAAAACATTAAGAGAGTATGTTGAATGAAATGAGTTATAGTAACAATTAATAGTAATTC
TAAATAAGTAAAGATAATAAGTAATATATAAATGAAAGTGATTGTGAAAGTAAAAATGAA
AGCGAAATAGACAACAGATAAAAATAAGAAGAATATGAAAATGATGATGATGACGATGAA
GATGGAGACGAAGACGACGATGATGATTTAATTTACCTAAAAAAAATTTTAAATAAAAAT
GTTTCAGAAAGACTTTCTTAGATATCTGAAAAAAAAAGTTAAGAGGAAAAAAGATAGTCA
TTATCAGATAAAAATAATTCTATGACACCTTAATTTATACAATAGAGTGGAGGAAGTTAA
AATTAAAGGAATGGCTCTATTTAACAAAAAGAAACATAAATGATACCTGAAACGGCTCAC
TAAAATAAACAATTTTAATCTTAGTAAATAAATTAGACTCAATACTATTAAAGAAAATCA
GAAAAAAGTGAAATTAGCTTCTAGTAATAATCAATATAATCACAAGAATATATGCATCTG
ATGATGGGTTCTGAAGAGTCCTCTAAGTTAGATATTAGAATAAATAGAAATATATTTCCT
AATAAAGTGTAAAATGAAAAAGAAAATAGCAATTCCATGTATGTATATGATGAAAATGCT
GAATATATGTCCTAACAATATATTGAGCATAATTCAGGATCATAAATGAATAATAAAAAG
AGAGTTCCTGCTGATGCACTTACTCCACAATAGGTTGAAGAGCAGTTAAAATTGAAAAAA
AAATTTATTCCTAGGCTATTTGAATGTCCAATATGCTTTTTATAACTCGATTCTTATGGT
AATGCTACATTTGTTAATAATCATATAACAAACTGTATGAAAGCCTAAGAGGAGAAATTT
AATAAGCTTGAATAAAATAATTCTTAATAAAATACATAGAAAGAAGAAAAAAAACCAGTT
TCTATATTAAATAATTATACCACAAAATAAGATACAAAGACAAAGTAAAGTGATAAAAAA
AATAGAAAGTCTGATTAAAAAAAATAGTAAAAAAACAGTTTTACATTAGATTCATTTGTA
ATAAAATAAAAAAATTGA