Identifiers and Description

Gene Model Identifier

TTHERM_00636920

Standard Name

POLD1 (DNA polymerase delta)

Aliases

PreTt19695 | 91.m00110

Description

DNA polymerase family B containing protein; homolog to human POLD1

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00136 ) DNA polymerase family B
  • ( TIGR00592 ) DNA polymerase (pol2)
  • ( PF03104 ) DNA polymerase family B, exonuclease

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00636920

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_304280
WormBaseWBGene000086459.997093137033517e-262DNA polymerase delta catalytic
subunit status:Confirmed
UniProt:P90829 protein_id:CA
B04077.1
Tetrahymena borealisEI9_03520.19.997093137033517e-262DNA polymerase family B contai
ning protein (1117 aa)
DictyBaseDDB_G02853819.997093137033517e-262polD1 on chromosome: 4 positio
n 3206066 to 3209653
OxytrichaContig17557.0.g869.997093137033517e-262DNA polymerase family B
SGDYDL102W9.997093137033517e-262POL3 Catalytic subunit of DNA
polymerase delta; required for
chromosomal DNA replication d
uring mitosis and meiosis, int
ragenic recombination, repair
of double strand DNA breaks, a
nd DNA replication during nucl
eotide excision repair (NER)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00636920(coding)
ATGAACGACGATAATAGTGACTATTCATAAGAGCCAGAAGACTTTGGAGATGAACTTATT
GAGGATGATTTTGATGATGTAGAATTTAATGAGGAAGAAGATATTGCCTTGCTTTAAGCT
AACGAAGATTAAGACTTATCAAATAAAAAATATTGTAGACCTCCAATTGATACTACAAAA
ATCAATGAATAAAATGACTTTTATTTTATGCAATTGGACGCAGATTATTATTTGGTCAGT
AATAATAAGAAAGATGGAGATCAAGGAGATGATAAATAAAAGTAAGCTTAAGAAAGTAAT
AAAAAAGAAGATGAAAATTCAGAAAGAGAGCCCATTATTAGAATGTATGGTGTTACAAAA
GACTAGCATTCGGTATTAGTAAGCATTCGTGGTGTAGTTCCTTATTTATTTGTGAGGTTA
CCTCCTTAAATATAACCTAACGCCTAAACTTTAAAATCTATTATGGATGACCTTAATAAA
CAAGGTAAATTCTAGAGAAATGTAAAAACTACTAATTTTATAAGGAAGATAGAAGTAGTT
AAGGGTGAATCAATAAAATATTACAAAGGAAAAGATTATGCTCAAGACACATATTTAAAG
ATATACACATTTATACCACCTTTCATTCCTGCTTTAAGAGGCATGATTGAAAAAGGTTAT
ACAATAGATGGTATAAGATTCCCAGCTGTAACTTTTGAATCGAATATACCATTTGCATTG
CGTTATATGATTGATGCAGATATCGTTGGTATGGGTTGGATCAAATTAGATAAAGAAAAA
TTTAAAATTCGTAGTCTTGATAAACATAAATCTAGATGCTAAATAGAAATTGATGTTGAT
TGTTAAAATGTACACGGTATGGATGCTTAAGACCCATAATGGGCTGATATTGCACCCTTA
AGAATATTCAGTTTTGATATTGAATGCCTTGCTAAATCAGGAGGTTTCCCAAATGCTTCA
AAGGATGATCCTATCATCTAAATAGCAACTGTGCTTAAAATACATGATTAGCAGGAAGAT
ATAGTAAGAACTGTATTTACGATGGATACTTGTTCCAATATTCCTGGTTGTATAGTCAAA
TCTTTTAAAACAGAAACAGAATTATTATTAGAATGGGAAAAGTTTTTGCAGAATGTAGAT
CCTGATATCTTTCTTGGATATAACATTACAAATTTCGATTTTCCTTACATTCTTGAGAGA
GGAAAGCAACTTAAAATTAATAATGGAAAGTATGGTTTCATGGGCAGAATTAAAAATACT
ATAACAAGAATTAAAGATGGCAAATACTTATCAAAGGCCATGGGTATGAGAGATACTAAA
GAAATGAACTTTGAAGGAAGAATTCAATTAGATATGATGATGCATATGCATAGAGAAACA
AAGTTAAGTAGTTATAGTCTTAATAGTGTTTCTTACCATTTCTTGAATGAGTAAAAAGAA
GATGTCCATCATACATAAATATCAGGTTTATAAAAAGGTGATGCTGAAACTCGTAAAAGA
TTAGCTGTTTACTGCTTAAAAGATGCTCAATTACCCTTAAAGCTAATGCAAAAACTTATG
TGTATTTACAATTATACAGAAATGGCTCGTGTCACAGGTGTTCCAATCAACTTTTTATTC
ACAAGAGGTTAATAAATTAAGGTTGCTAGTCAACTCTATAGGAGAACTAAACTTTTGAAC
TTATATATTCCTACTGAACGCTCTTAAGGTTAAGGAGATAAATTTGAAGGTGCTTTCGTT
CTCTAACCTAAAAAGGGATTTTATGATAAGCCTATAGCAACTTTAGATTTTGCTTCTTTG
TATCCTTCAATTATGATGGCCCACAACCTTTGTTATTCTACTCTTATTAGCAAAAATGTG
GCTATGAGTATGAACAAAGATGACTACACTTTAACTCCTCATGGAGATTACTTTGCTAAA
CCACATGTAAGATAGGGCATTCTACCTGATATCTTAAAGGATCTTTTAGCAGCAAGAAAA
AAAGCCAAAAATGAACTTGCTAAAGAAACAGATCCTCTTAGAAAGGCCGTCTTAGATGGT
AGATAGTTAGCTCTTAAAATATCTGCAAACTCTGTCTACGGTTTCACTGGTGCTCAAGTA
GGTTAACTACCTTGTCTCGAAATTTCATCTTCAGTTACATCTTTTGGTCGTTAGATGATT
GAAGCAACAAGAGATTTTGTTCTCAATCACTATAACAAAGCAAATGGATACAACTATGAT
TCTGATGTAATATATGGTGATACTGATTCAGTCATGGTTAAATTTGGTTGTGATTCTATT
GAAGAAGCTATGAAGTATGGTAAAGAAGCAGCTGAAATGATTAGCAAAAAACTCTTTATT
AATCCTATTAAACTTGAATTCGAAAAGGTCTATTATCCTTATCTCTTGATTTCAAAAAAG
CGTTATGCTGGATGTTTTTACACAAAGCCAGATAAATATGATAAAATCGATACTAAGGGT
ATGGAAAATGTAAGAAGAGATAATTGCTAATTTATTAGAGAAATGATGAATACTTGCTTG
AGGTATATTCTTGTCGAACACAAATAAGACGGTGTTCAGAGATCAATTTAATTCATAAAA
GGTTGCATATCAGATTTGTATCAAAATAAAGTTGATATTTCTAAACTGGTGATTACTAAA
TCTTTAACGAAAAAATCAGCAGACGATGATGAAGGCGAAGAAGATGGTAAAAAAGGTAGT
AGTCATAATAATAAGGCAAAAGAACCCTCTGCTAATTAGTACAAAGGTAAATAAGCACAT
GTTGAATTGGCTAAAAAAATGGCTAAAAGAGATCCAGGAAGTGCTCCTTGTATTGGAGAT
AGAATTCCTTATGTTATAGTAGCAGGAGCAAAATCAGCTAAAAATTATGAAAAAGTAGAA
GATCCAATTTATGTGTTAGAAAACGATATCCCTTTAGATTACGATTATTACATTGAAAAG
CAAATTAAAAATCCTATTACTCGTATTTATTCCCACATCATAGATAATGTTGATTCGTTA
TTCTATGGAGAGCATACTAAAAATAGATATCAACCTAAAGTTAATAGTGGACATGGTTTA
GGAAAATTCATTGTAAAAAAAGAAAGTTGCTTACAATGTAAATGCTAAGTAAATGGTAAA
TAGCCTGTTTGTGATAATTGTCTTGAAAAAAATCCTCAGAGATTGATTGATATATACACT
GAAAAAATTATTTAGCATCAATCTATCGAGTATTAATATAACTAACTTTGGACTTAGTGC
CAAAGATGCCAAGGAAGTTTGCACGAATAAGTAATTTGCTCAAATAGAGACTGCCCTATT
TATTACAAGAGAACTAAATTATAAACTGATTTATCTAGATCATAATAATTATTATCACGT
TTTGATGAATGGTGA


>TTHERM_00636920(protein)
MNDDNSDYSQEPEDFGDELIEDDFDDVEFNEEEDIALLQANEDQDLSNKKYCRPPIDTTK
INEQNDFYFMQLDADYYLVSNNKKDGDQGDDKQKQAQESNKKEDENSEREPIIRMYGVTK
DQHSVLVSIRGVVPYLFVRLPPQIQPNAQTLKSIMDDLNKQGKFQRNVKTTNFIRKIEVV
KGESIKYYKGKDYAQDTYLKIYTFIPPFIPALRGMIEKGYTIDGIRFPAVTFESNIPFAL
RYMIDADIVGMGWIKLDKEKFKIRSLDKHKSRCQIEIDVDCQNVHGMDAQDPQWADIAPL
RIFSFDIECLAKSGGFPNASKDDPIIQIATVLKIHDQQEDIVRTVFTMDTCSNIPGCIVK
SFKTETELLLEWEKFLQNVDPDIFLGYNITNFDFPYILERGKQLKINNGKYGFMGRIKNT
ITRIKDGKYLSKAMGMRDTKEMNFEGRIQLDMMMHMHRETKLSSYSLNSVSYHFLNEQKE
DVHHTQISGLQKGDAETRKRLAVYCLKDAQLPLKLMQKLMCIYNYTEMARVTGVPINFLF
TRGQQIKVASQLYRRTKLLNLYIPTERSQGQGDKFEGAFVLQPKKGFYDKPIATLDFASL
YPSIMMAHNLCYSTLISKNVAMSMNKDDYTLTPHGDYFAKPHVRQGILPDILKDLLAARK
KAKNELAKETDPLRKAVLDGRQLALKISANSVYGFTGAQVGQLPCLEISSSVTSFGRQMI
EATRDFVLNHYNKANGYNYDSDVIYGDTDSVMVKFGCDSIEEAMKYGKEAAEMISKKLFI
NPIKLEFEKVYYPYLLISKKRYAGCFYTKPDKYDKIDTKGMENVRRDNCQFIREMMNTCL
RYILVEHKQDGVQRSIQFIKGCISDLYQNKVDISKLVITKSLTKKSADDDEGEEDGKKGS
SHNNKAKEPSANQYKGKQAHVELAKKMAKRDPGSAPCIGDRIPYVIVAGAKSAKNYEKVE
DPIYVLENDIPLDYDYYIEKQIKNPITRIYSHIIDNVDSLFYGEHTKNRYQPKVNSGHGL
GKFIVKKESCLQCKCQVNGKQPVCDNCLEKNPQRLIDIYTEKIIQHQSIEYQYNQLWTQC
QRCQGSLHEQVICSNRDCPIYYKRTKLQTDLSRSQQLLSRFDEW


>TTHERM_00636920(gene)
ATGAACGACGATAATAGTGACTATTCATAAGAGCCAGAAGACTTTGGAGATGAACTTATT
GAGGATGATTTTGATGATGTAGAATTTAATGAGGAAGAAGATATTGCCTTGCTTTAAGCT
AACGAAGATTAAGACTTATCAAATAAAAAATATTGTAGACCTCCAATTGATACTACAAAA
ATCAATGAATAAAATGACTTTTATTTTATGCAATTGGACGCAGATTATTATTTGGTCAGT
AATAATAAGAAAGATGGAGATCAAGGAGATGATAAATAAAAGTAAGCTTAAGAAAGTAAT
AAAAAAGAAGATGAAAATTCAGAAAGAGAGCCCATTATTAGAATGTATGGTGTTACAAAA
GACTAGCATTCGGTATTAGTAAGCATTCGTGGTGTAGTTCCTTATTTATTTGTGAGGTTA
CCTCCTTAAATATAACCTAACGCCTAAACTTTAAAATCTATTATGGATGACCTTAATAAA
CAAGGTAAAAAAATATACAAATTTATATAAGCTTATAAAGAATTCATTAAATATGTTTCA
TTAATTAATACATAGGTAAATTCTAGAGAAATGTAAAAACTACTAATTTTATAAGGAAGA
TAGAAGTAGTTAAGGGTGAATCAATAAAATATTACAAAGGAAAAGATTATGCTCAAGACA
CATATTTAAAGATATACACATTTATACCACCTTTCATTCCTGCTTTAAGAGGCATGATTG
AAAAAGGTTATACAATAGATGGTATAAGATTCCCAGCTGTAACTTTTGAATCGAATATAC
CATTTGCATTGCGTTATATGATTGATGCAGATATCGTTGGTATGGGTTGGATCAAATTAG
ATAAAGAAAAATTTAAAATTCGTAGTCTTGATAAACATAAATCTAGATGCTAAATAGAAA
TTGATGTTGATTGTTAAAATGTACACGGTATGGATGCTTAAGACCCATAATGGGCTGATA
TTGCACCCTTAAGAATATTCAGTTTTGATATTGAATGCCTTGCTAAATCAGGAGGTTTCC
CAAATGCTTCAAAGTATGTTAGTTCATAATGAAGATATAATTTTAACAAATTTATTAATT
ATTTTAAAAGGGATGATCCTATCATCTAAATAGCAACTGTGCTTAAAATACATGATTAGC
AGGAAGATATAGTAAGAACTGTATTTACGATGGATACTTGTTCCAATATTCCTGGTTGTA
TAGTCAAATCTTTTAAAACAGAAACAGAATTATTATTAGAATGGGAAAAGTTTTTGCAGA
ATGTAGATCCTGATATCTTTCTTGGATATAACATTACAAATTTCGATTTTCCTTACATTC
TTGAGAGAGGAAAGCAACTTAAAATTAATAATGGAAAGTAATTCGTTTTCAAACTATGAA
TATTTCTTAAAAATGTTTATATATTAGGTATGGTTTCATGGGCAGAATTAAAAATACTAT
AACAAGAATTAAAGATGGCAAATACTTATCAAAGGCCATGGGTATGAGAGATGTAAACAA
TTATTTATTTATTTTAAAACACCTTTATTTATTTGTTTATTTATTTATTTTATCTAATAA
TTTGCTTTCTAAAGACTAAAGAAATGAACTTTGAAGGAAGAATTCAATTAGATATGATGA
TGCATATGCATAGAGAAACAAAGTTAAGTAGTTATAGTCTTAATAGTGTTTCTTACCATT
TCTTGAATGAGTAAAAAGAAGATGTCCATCATACATAAATATCAGGTTTATAAAAAGGTG
ATGCTGAAACTCGTAAAAGATTAGCTGTTTACTGCTTAAAAGATGCTCAATTACCCTTAA
AGCTAATGCAAAAACTTATGTGTATTTACAATTATACAGAAATGGCTCGTGTCACAGGTA
TTTGATTTTTTTAAAAACGACTATAGTTATTTATTTTTATTAATAATATTAGGTGTTCCA
ATCAACTTTTTATTCACAAGAGGTTAATAAATTAAGGTTGCTAGTCAACTCTATAGGAGA
ACTAAACTTTTGAACTTATATATTCCTACTGAACGCTCTTAAGGTTAAGGAGATAAATTT
GAAGGTGCTTTCGTTCTCTAACCTAAAAAGGGATTTTATGATAAGCCTATAGCAACTTTA
GATTTTGCTTCTTTGTATCCTTCAATTATGATGGCCCACAACCTTTGTTATTCTACTCTT
ATTAGCAAAAGTACAATTATAAAATTTAGTTTAAAAAAAATATAAAATTCTTATTTATTA
ATTAGATGTGGCTATGAGTATGAACAAAGATGACTACACTTTAACTCCTCATGGAGATTA
CTTTGCTAAACCACATGTAAGATAGGGCATTCTACCTGATATCTTAAAGGATCTTTTAGC
AGCAAGAAAAAAAGCCAAAAATGAACTTGCTAAAGAAACAGATCCTCTTAGAAAGGCCGT
CTTAGATGGTAGATAGTTAGCTCTTAAAATATCTGCAAACTCTGTCTACGGTTTCACTGG
TGCTCAAGTAGGTTAACTACCTTGTCTCGAAATTTCATCTTCAGTTACATCTTTTGGTCG
TTAGATGATTGAAGCAACAAGAGATTTTGTTCTCAATCACTATAACAAAGCAAATGGATA
CAACTATGATTCTGATGTAAAAAAATAAATATATAAAAATAAAATTAAAAAAATAAATAA
TTATAGGTAATATATGGTGATACTGATTCAGTCATGGTTAAATTTGGTTGTGATTCTATT
GAAGAAGCTATGAAGTATGGTAAAGAAGCAGCTGAAATGATTAGCAAAAAACTCTTTATT
AATCCTATTAAACTTGAATTCGAAAAGGTCTATTATCCTTATCTCTTGATTTCAAAAAAG
CGTTATGCTGGATGTTTTTACACAAAGCCAGATAAATATGATAAAATCGATACTAAGGGT
ATGGAAAATGTAAGAAGAGATAATTGCTAATTTATTAGAGAAATGATGAATACTTGCTTG
AGGTATATTCTTGTCGAACACAAATAAGACGGTGTTCAGAGATCAATTTAATTCATAAAA
GGTTGCATATCAGATTTGTATCAAAATAAAGTTGATATTTCTAAACTGGTGATTACTAAA
TCTTTAACGAAAAAATCAGCAGACGATGATGAAGGCGAAGAAGATGGTAAAAAAGGTAGT
AGTCATAATAATAAGGCAAAAGAACCCTCTGCTAATTAGTACAAAGGTAAATAAGCACAT
GTTGAATTGGCTAAAAAAATGGCTAAAAGAGATCCAGGAAGTGCTCCTTGTGTAATTATT
TTTAATTTAAAATAAAATGAAAAATAAATAATATTTTAAAATAAATAAATTAGATTGGAG
ATAGAATTCCTTATGTTATAGTAGCAGGAGCAAAATCAGCTAAAAATTATGAAAAAGTAG
AAGATCCAATTTATGTGTTAGAAAACGATATCCCTTTAGATTACGATTATTACATTGAAA
AGCAAATTAAAAATCCTATTACTCGTATTTATTCCCACATCATAGATAATGTTGATTCGT
TATTCTATGGAGAGCATACTAAAAATAGATATCAACCTAAAGTTAATAGTGGACATGGTT
TAGGAAAATTCATTGTAAAAAAAGAAAGTTGCTTACAATGTAAATGCTAAGTAAATGGTA
AATAGCCTGTTTGTGATAATTGTCTTGAAAAAAATCCTCAGAGATTGATTGATATATACA
CTGAAAAAATTATTTAGCATCAATCTATCGAGTATTAATATAACTAACTTTGGACTTAGT
GCCAAAGATGCCAAGGAAGTTTGCACGAATAAGTAATTTGCTCAAATAGAGACTGCCCTA
TTTATTACAAGAGAACTAAATTATAAACTGATTTATCTAGATCATAATAATTATTATCAC
GTTTTGATGAATGGTGA