Identifiers and Description

Gene Model Identifier

TTHERM_00732550

Standard Name

POLB1 (human homolog to POLB)

Aliases

PreTt02776 | 119.m00101

Description

Helix-hairpin-helix motif family protein; member of the replicative DNA polymerases

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00732550

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18481.19.997093137033517e-262helix-hairpin-helix domain-con
taining protein family protein
(818 aa)
OxytrichaContig16033.0.g638.997107083354175e-87Fingers domain of DNA polymera
se lambda
Stentor CoeruleusSteCoe_196717.984904245686979e-30
DictyBaseDDB_G02847137.002116201343823e-26polB on chromosome: 4 position
2376164 to 2378598
SGDYCR014C0.0000000000019997478866288316POL4 DNA polymerase IV, underg
oes pair-wise interactions wit
h Dnl4p-Lif1p and Rad27p to me
diate repair of DNA double-str
and breaks by non-homologous e
nd joining (NHEJ); homologous
to mammalian DNA polymerase be
ta

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00732550(coding)
ATGAGCTAGCTTGATTAAATTCTTGAAGAAGCTGTTAAAAAAAATGAAAATAATAAAAGA
GAAGTCAAAAATCCTTTGACTAAAGAAATGATTCAATATCAAAAAGTTCTAGAAAGCCAG
TAGCTTAAGAGCTAAATTAACTAGTAACATGCAAAAAAAGAAGTAAAGAAAGAATATATC
GTTATAGATGAGGATTCTACAGATATTTATCAATAAAATAAAATATAAAACACATAAAAT
GGATCTTAAAAAGTAAAATATGTTGATATTTTAAAATAAAGATAAGAGGAAATAAATAAA
ATACCTAAAGACCTTTTTAAGTCAAAAATTGTTATCTTTTTTATGAGGAATTTCGATTTA
AGTGAAAAAAGAGTTAAAATTTTTGCGGAATAAATCAAAAATAATTAAGGGGAGGTTTAT
TTTTCTATTTAAGAATATTTTGAAAAATTTCTTACATTTTACGATCTTATACAAGAAAAA
AATAAACACATTTTATTCATCTGTCCAGATAACATAAAAATTGATGAGCTGAGAAAATAG
CTATCATAATACAGTTTAGATTTAGACGTTGTAATAAATAAAGTGGTTATTTCAGAATAT
CTTGTTGAAGTTCTCAAATAAAAAAAATATATTAATCCTGAACCCTATTACTTCTCTTAT
ATAAATTAGCTTGCAGCCTAAAATAATTTATTCCATGTAGGATAGTAAGAGGAAATCAAT
AAAGAAAAATAATAAATTAAAAATATGAATATTTCACAATCTTAGTAGATTATAGATGAA
AACAGTAAATAACTCTCTAATTCAAAAGTGAGCAGCGATGAAGATTCAATTTAGGAAAAT
AGTTTAGATTTAGAATGCCTTACTAACATTTCTCGTGATATTTTAAGACAGAGAAAAATG
AAGTAAGATACAAGTAGATAAAAAGCTGCTAAAAAAACTCGATACCTTTGGGATTATAAT
TATGATAGTGAATAAGAGTAACAAATAAGTGAAGATGATTTAGAGAAATCATAAAATTCT
GACAAATTTGTTTCTTTTGATTCTTCATTTGAACAAAAAAAGGCAGAATATGCTGATTAA
TCTATCACACCTATAAAGTTAGATAATTAACTATTTTTAAGTAAAGTAACAGAAAATGAA
GAAATTAGTGGTTAAAAAATTAATTATTTAACTTCGTTTAAAAAACTGAAAAGAAGTCCT
CAACTAGATAATAAAAACTCATAAGATTAGTTTTTATTTAAAATCAGTAAAAGTACTATA
AAAAAAGAATAAGATTTGATCTAATAAAATTAAACTTCGCCTTCTAAAACTGGATTTAAA
AATAAAAACTAACTTGATTATTTTGAAGTGGACTCTGATTAGGAGATTCAAATAAAAGAT
GAATAAAAATACTTGGATTATTTGGATGAAGATGATGAAGATTTTTCTAAAATAGATTAA
AGATTTATCACGGAACTTCCTAATTTAAAAGTTGAAGCAAAATTTAAAAATGATCAATAG
CTTAAAAGTTTGAAGAAAAAAGATAAAATCATAGAAATTATTTCACTTGATAGTGATGAA
GATGAAAAAGAAACTAATTTGGGTTAGTAAATTAATGATTAAGAATAGCCAAAATTTGTT
TCTTAGCCAAATATAGGTAATCCATTCAAACCATTTAGCGGATAAATAAGAAGAGAAAGG
TATTGGGATGAAAGAAAAGATCATTTTATTTGTGCCACTGGAGCACCGAAAGAAAATTTT
AACAAATTAATTACGGAAGAATTAGAAAAGCTTCTAAAAATCTACTAATAAGAGAAAGAT
ATCGGGAGGTCAATTGCATATAGAAAAGCAGTGGGTATTATCAAATCATTAGATTTTCAA
ATAAAATCAGTTAAAGATGTGTAAAAAATAAATGGACTTGGTGAAAAAACAAAAGAAAAA
ATAAAAGAAATCTTAGAAACAGGTCAATGTCAAAGAGCTTAAATTTTAACTTAAAGTGAA
AGAAATTAAGCTATTGAGTTACTTTCGTAAGTATGGGGTATAGGACCTTCAACAGCTTCT
CAACTATATGAAAGGAATATAAAAACTATAGCTGAACTAAGATAAAATTAGCATCTCTTA
AATAAAAATTAAAAAATTGGTTTGTAATATTTTGAAGATTTGGTAGAAAGAATGCCAAGA
GAAGAAGCTACTTTAATAGTAAATGAAGTCATAAAAGGATTTAAAGAGTTATATCCTGAA
GAACACGATAGGTATGATATTATAGCCTGTGGTTCTTATAGAAGAGGTAAAGAAACGTGT
GGTGATGTAGATATTTTAATTTGTAGAAAAGATGGGGAGGAAAATAAACCTAAAAAATTA
ATGATAAATTTGATTTGTAAATTAGAATAAGATGGGTTGTTGATTGAGCATTTGTAATTC
CCAAGACCAAATTAGTATGGGAGTGAAACTTATATGGGAATTGGAAAATTAAAAGACGGA
AAACATAGACGTATTGATCTAAAATATTATCCTAAGGACCTTTACGGTTATGCCCTTTTA
TATTTTACAGGGAGTGATTATTTTAACAGAAGTATGAGATTGTTTGCAAGGAAAAAAGGC
TATTCTCTTTCTGATCATGGCCTTTATGCAGTTAATAGAATAGACAACAAAACAAAAATA
ACTTCCTCATTAGCTATTCCTTGTTATACTGAGGAGGAAGTCTTTGCAGCACTAAATTTA
GAGTACAAACCACCTTATATGAGAAGTGTATGA


>TTHERM_00732550(protein)
MSQLDQILEEAVKKNENNKREVKNPLTKEMIQYQKVLESQQLKSQINQQHAKKEVKKEYI
VIDEDSTDIYQQNKIQNTQNGSQKVKYVDILKQRQEEINKIPKDLFKSKIVIFFMRNFDL
SEKRVKIFAEQIKNNQGEVYFSIQEYFEKFLTFYDLIQEKNKHILFICPDNIKIDELRKQ
LSQYSLDLDVVINKVVISEYLVEVLKQKKYINPEPYYFSYINQLAAQNNLFHVGQQEEIN
KEKQQIKNMNISQSQQIIDENSKQLSNSKVSSDEDSIQENSLDLECLTNISRDILRQRKM
KQDTSRQKAAKKTRYLWDYNYDSEQEQQISEDDLEKSQNSDKFVSFDSSFEQKKAEYADQ
SITPIKLDNQLFLSKVTENEEISGQKINYLTSFKKLKRSPQLDNKNSQDQFLFKISKSTI
KKEQDLIQQNQTSPSKTGFKNKNQLDYFEVDSDQEIQIKDEQKYLDYLDEDDEDFSKIDQ
RFITELPNLKVEAKFKNDQQLKSLKKKDKIIEIISLDSDEDEKETNLGQQINDQEQPKFV
SQPNIGNPFKPFSGQIRRERYWDERKDHFICATGAPKENFNKLITEELEKLLKIYQQEKD
IGRSIAYRKAVGIIKSLDFQIKSVKDVQKINGLGEKTKEKIKEILETGQCQRAQILTQSE
RNQAIELLSQVWGIGPSTASQLYERNIKTIAELRQNQHLLNKNQKIGLQYFEDLVERMPR
EEATLIVNEVIKGFKELYPEEHDRYDIIACGSYRRGKETCGDVDILICRKDGEENKPKKL
MINLICKLEQDGLLIEHLQFPRPNQYGSETYMGIGKLKDGKHRRIDLKYYPKDLYGYALL
YFTGSDYFNRSMRLFARKKGYSLSDHGLYAVNRIDNKTKITSSLAIPCYTEEEVFAALNL
EYKPPYMRSV


>TTHERM_00732550(gene)
ATGAGCTAGCTTGATTAAATTCTTGAAGAAGCTGTTAAAAAAAATGAAAATAATAAAAGA
GAAGTCAAAAATCCTTTGACTAAAGTAAAAAAAGTTCTAAGGTAAAAAGAAATGTCTATT
CATTTTTGTTTTTAATAAAGGAAATGATTCAATATCAAAAAGTTCTAGAAAGCCAGTAGC
TTAAGAGCTAAATTAACTAGTAACATGCAAAAAAAGAAGTAAAGAAAGAATATATCGTTA
TAGATGAGGATTCTACAGATATTTATCAATAAAATAAAATATAAAACACATAAAATGGAT
CTTAAAAAGTAAAATATGTTGATATTTTAAAATAAAGATAAGAGGAAATAAATAAAATAC
CTAAAGTAAGTTCATTTATTGATCTTTTAAAGAGACTATATATAGTTTGTTTACTTTATA
AATAAAGGACCTTTTTAAGTCAAAAATTGTTATCTTTTTTATGAGGAATTTCGATTTAAG
TGAAAAAAGAGTTAAAATTTTTGCGGAATAAATCAAAAATAATTAAGGGGAGGTTTATTT
TTCTATTTAAGAATATTTTGAAAAATTTCTTACATTTTACGATCTTATACAAGAAAAAAA
TAAACACATTTTATTCATCTGTCCAGATAACATAAAAATTGATGTAAAATACTTTAAATT
AATTATTATATAATTAATTTAAATTTTTTAATAAAGGAGCTGAGAAAATAGCTATCATAA
TACAGTTTAGATTTAGACGTTGTAATAAATAAAGTGGTTATTTCAGAATATCTTGTTGAA
GTTCTCAAATAAAAAAAATATATTAATCCTGAACCCTATTGTAAATTAATTTTAATCAAA
TTTTATTTAATAAATTTTATTAAAATAAGACTTCTCTTATATAAATTAGCTTGCAGCCTA
AAATAATTTATTCCATGTGTAAATTAATATTAGCTTTGCTGATAAATTAATTTTTTTTAT
ACTGGCTTAAAATAGAGGATAGTAAGAGGAAATCAATAAAGAAAAATAATAAATTAAAAA
TATGAATATTTCACAATCTTAGTAGATTATAGATGAAAACAGTAAATAACTCTCTAATTC
AAAAGTGAGCAGCGATGAAGATTCAATTTAGGAAAATAGTTTAGATTTAGAATGCCTTAC
TAACATTTCTCGTGATATTTTAAGACAGAGAAAAATGAAGTAAGATACAAGTAGATAAAA
AGCTGCTAAAAAAACTCGATACCTTTGGGATTATAATTATGATAGTGAATAAGAGTAACA
AATAAGTGAAGATGATTTAGAGAAATCATAAAATTCTGACAAATTTGTTTCTTTTGATTC
TTCATTTGAACAAAAAAAGGCAGAATATGCTGATTAATCTATCACACCTATAAAGTTAGA
TAATTAACTATTTTTAAGTAAAGTAACAGAAAATGAAGAAATTAGTGGTTAAAAAATTAA
TTATTTAACTTCGTTTAAAAAACTGAAAAGAAGTCCTCAACTAGATAATAAAAACTCATA
AGTATTTTTTATAAATTATTTATTTTTCAAATTAATAAAATGCTTTTAATATGAAAAGGA
TTAGTTTTTATTTAAAATCAGTAAAAGTACTATAAAAAAAGAATAAGATTTGATCTAATA
AAATTAAACTTCGCCTTCTAAAACTGGATTTAAAAATAAGTAAATGTTGTTTTTTAATTT
ATTAGACTTCAACTTAATTTCTTTTGAAAAAAAATAGAAACTAACTTGATTATTTTGAAG
TGGACTCTGATTAGGAGATTCAAATAAAAGATGAATAAAAATACTTGGATTATTTGGATG
AAGATGATGAAGATTTTTCTAAAATAGATTAAAGATTTATCACGGAACTTCCTAATTTAA
AAGTTGAAGCAAAATTTAAAAATGATCAATAGCTTAAAAGTTTGAAGAAAAAAGATAAAA
TCATAGAAATTATTTCACTTGATAGTGATGAAGATGAAAAAGAAACTAATTTGGGTTAGT
AAATTAATGATTAAGAATAGCCAAAATTTGTTTCTTAGCCAAATATAGGTAATCCATTCA
AACCATTTAGCGGATAAATAAGAAGAGAAAGGTATTGGGATGAAAGAAAAGATCATTTTA
TTTGTGCCACTGGAGCACCGAAAGAAAATTTTAACAAATTAATTACGGAAGTATTCAAAT
TTTGATTTAAAAAATGCTAAATTAAAATAATTAAATATTTTTATTATCTTAAATTTAGGA
ATTAGAAAAGCTTCTAAAAATCTACTAATAAGAGAAAGATATCGGGAGGTCAATTGCATA
TAGAAAAGCAGTGGGTATTATCAAATCATTAGATTTTCAAATAAAATCAGTTAAAGATGT
GTAAAAAATAAATGGACTTGGTGAAAAAACAAAAGAAAAAATAAAAGAAATCTTAGAAAC
AGGTCAATGTCAAAGAGCTTAAATTTTAACTTAAAGTGAAAGAAATTAAGCTATTGAGTT
ACTTTCGTAAGTATGGGGTATAGGACCTTCAACAGCTTCTCAACTATATGAAAGGAATAT
AAAAACTATAGCTGAACTAAGATAAAATTAGCATCTCTTAAATAAAAATTAAAAAATTGG
TTTGTAATATTTTGAAGATTTGGTAGAAAGAATGCCAAGAGAAGAAGCTACTTTAATAGT
AAATGAAGTCATAAAAGGTTTTTTATTATTTGCATATTTATTTTTTCATTTGAAGACAAT
TTCAAATCATCAAATTTTTTTCAATCTTAAATAAAGTTTTTACAATATTTTTATTTATAA
CTTAAAGTTATTTACTTGATCTCTTAAAATTTACAATATATTTTAATTAGGATTTAAAGA
GTTATATCCTGAAGAACACGATAGGTATGATATTATAGCCTGTGGTTCTTATAGAAGAGG
TACTTACTTTGAAAATTTACAAATCAATATCTATTCACTTTAATAAATTGAAAAAATATT
TTAGGTAAAGAAACGTGTGGTGATGTAGATATTTTAATTTGTAGAAAAGATGGGGAGGAA
AATAAACCTAAAAAATTAATGATAAATTTGATTTGTAAATTAGAATAAGATGGGTTGTTG
ATTGAGCATTTGTAATTCCCAAGACCAAATTAGTATGGGAGTGAAACTTATATGGGAATT
GGAAAATTAAAAGACGGAAAACATAGACGTATTGATCTAAAATATTATCCTAAGGACCTT
TACGGTTATGCCCTTTTATATTTTACAGGGAGTGATTATTTTAACAGAAGTATGAGATTG
TTTGCAAGGAAAAAAGGCTATTCTCTTTCTGATCATGGCCTTTATGCAGTTAATAGAATA
GACAACAAAACAAAAATAACTTCCTCATTAGCTATTCCTTGTTATACTGAGGAGGAAGTC
TTTGCAGCACTAAATTTAGAGTACAAACCACCTTATATGAGAAGTGTATGA