Identifiers and Description

Gene Model Identifier

TTHERM_00691170

Standard Name

POL31 (DNA polymerase delta subunit 2)

Aliases

PreTt02955 | 106.m00095 | 3674.m00008

Description

Homolog of Saccharomyces POL 31, Subunit of DNA polymerase delta (polymerase III); involved in DNA replication and repair.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF08031 ) Berberine and berberine like
  • ( PF04042 ) DNA polymerase epsilon subunit B

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00691170

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17619.19.997093137033517e-262hypothetical protein (488 aa)
OxytrichaContig19882.0.g61.0004460510701209e-64DNA polymerase alpha/epsilon s
ubunit B
DictyBaseDDB_G02816419.999353957415832e-59polD2 on chromosome: 3 positio
n 4748825 to 4750464
SGDYJR006W1.000159011384939e-43POL31 DNA polymerase III (delt
a) subunit, essential for cell
viability; involved in DNA re
plication and DNA repair
WormBaseWBGene000087222.000470901975128e-28Probable DNA polymerase delta
small subunit status:Confirm
ed UniProt:Q19366 protein_
id:CAA97785.1
Stentor CoeruleusSteCoe_28763.873997628687187e-21

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00691170(coding)
ATGGAAATAGAGAGACCAAAAAAAGCTGACACTATAAAGTTGCTTTCAACATATAAATCT
AGTGTAACAGGAAATTTAGTTAGGCCAGATTGCTAAGGATATAAAAACGTAAGCGAATAA
TTCATCCTTAAAGATAGCTAAAAGAAATATGATATACAATATTGGAAGACATACTTTAAA
AGATTAGATTAGATTAAGGAATATTTTATGTCAAATTTTAGTGAAGAATCTATTCCTATT
TGCGATAAAATATTAAACATAAAAGTAGGGGAACACTAAGTTGTGATTGCAACCCTTTAC
AAGGATATGAAATTAAAACCTAATGTACTTACTGTCTCATAATAAAGAGATAACTACATG
GCTGATGACGACGTAATTTATATGGAAGACTAGACAGGTAGAATGTAGTTAGCATTCAAC
AATACACAATTTAAAAGCTCAATCAGCAAGCCAAAAACAATTGATGTGAAGAATTTAACT
TCAGGATTAGTTGTAGGTATAAGGGGTATTTAAAGAGTAGCTGAAATTAACGTATTTGAA
GTTGAAGAGATTTATTGTTGTGATTTACCTCATTAAGAACATATCCTTAAAATACCAGCT
CCTTTGACTTATGGTGATGACTCTCATTTAGAAAATAACAACAATTTCCATGATCTTTCT
CATTATATCAAAAACTATTAAGATCACAAATTTATACTACTAACTTCAGGTTTAAACATT
GATCCAAACGTTGATAGATACACTCTTATATAGCTTAAAAATCATCTATTTGGATTGACA
AATCTAAAACCATTAATGTCAAGAGTTTGTAGAGTTGTAATGGCTGGTAACTTAATTGAA
AAGAATAAAGATTTAGATTATAATTTAGTTGGTTCATATCGTATGCAGGAATAATTTAAA
TAACTTTATGCAGAAATTGCTAAAAAGATGCATGATGTAGATAAAAATATTAATGAAATT
GCTGGAAATGTTTGTTTAGATATTATGCCAGGAGATAAAGATCCTGCATAAGCATTTTTA
CCTTAACAATCCTTGAATAAGTGTTATTTTGCATCATCCAAATCTATTCCAACACTTAAT
CTTGTTTCTAATCCTTATAAATTTGAATAAGAAAATATTTAAATATTAGGTGTATCAGGA
TAGAGTATGCTTGACATTAAAAAATATAGCAATTACAGCGATTAGGATATAGACATACTA
TAATCACATTTACTATGGAGACATATTTCACCTACTTCTCCTGATACTTTATAATGTTTC
CCATTCCATGAAAGTGATCCTTTTATTTTAGATGAGCTTCCTCATGTTTATTTTAGTGGA
AATAGTCCTAAATTTGAAACAAAAATGGTATATGAAGAGAACACTAAAAAGAGATGTAGA
TTAATTTGTGTCCCTGCTTTATCTGCTAGTAATTCTTTTGTAATAATGAATCTAGCTAAC
TTAGATACATTTGAAATTAAATTATGA


>TTHERM_00691170(protein)
MEIERPKKADTIKLLSTYKSSVTGNLVRPDCQGYKNVSEQFILKDSQKKYDIQYWKTYFK
RLDQIKEYFMSNFSEESIPICDKILNIKVGEHQVVIATLYKDMKLKPNVLTVSQQRDNYM
ADDDVIYMEDQTGRMQLAFNNTQFKSSISKPKTIDVKNLTSGLVVGIRGIQRVAEINVFE
VEEIYCCDLPHQEHILKIPAPLTYGDDSHLENNNNFHDLSHYIKNYQDHKFILLTSGLNI
DPNVDRYTLIQLKNHLFGLTNLKPLMSRVCRVVMAGNLIEKNKDLDYNLVGSYRMQEQFK
QLYAEIAKKMHDVDKNINEIAGNVCLDIMPGDKDPAQAFLPQQSLNKCYFASSKSIPTLN
LVSNPYKFEQENIQILGVSGQSMLDIKKYSNYSDQDIDILQSHLLWRHISPTSPDTLQCF
PFHESDPFILDELPHVYFSGNSPKFETKMVYEENTKKRCRLICVPALSASNSFVIMNLAN
LDTFEIKL


>TTHERM_00691170(gene)
ATGGAAATAGAGAGACCAAAAAAAGCTGACACTATAAAGTTGCTTTCAACATATAAATCT
AGTGTAACAGGAAATTTAGTTAGGCCAGATTGCTAAGGATATAAAAACGTAAGCGAATAA
TTCATCCTTAAAGATAGCTAAAAGAAATATGATATACAATATTGGAAGACATACTTTAAA
AGATTAGATTAGATTAAGGAATATTTTATGTCAAATTTTAGTGAAGAATCTATTCCTATT
TGCGATAAAATATTAAACATAAAAGTAGGGGAACACTAAGTTGTGATTGCAACCCTTTAC
AAGGATATGAAATTAAAACCTAATGTACTTACTGTCTCATAATAAAGAGGTATTTAGCAA
ATTGATAAATTCATAGAAATTTTACCCTTGACGAAAGTTTTTTTTAAAAAATGCTTAAAC
TTATTCCTTATTATTTAGATAACTACATGGCTGATGACGACGTAATTTATATGGAAGACT
AGACAGGTAATAAAATTAAAATTCTATCATTTCAATTATTTTATTTGTATAAAAATAAAA
TATTAAAGGTAGAATGTAGTTAGCATTCAACAATACACAATTTAAAAGCTCAATCAGCAA
GCCAAAAACAATTGATGTGAAGAATTTAACTTCAGGATTAGTTGTAGGTATAAGGGGTAT
TTAAAGAGTAGCTGAAATTAACGTATTTGAAGTTGAAGAGATTTATTGTTGTGATTTACC
TCATTAAGAACATATCCTTAAAATACCAGCTCCTTTGACTTATGGTGATGACTCTCATTT
AGAAAATAACAACAATTTCCATGATCTTTCTCATTATATCAAAAACTATTAAGATCACAA
ATTTATACTACTAACTTCAGGTTTAAACATTGATCCAAACGTTGATAGATACACTCTTAT
ATAGCTTAAAAATCATCTATTTGGATTGACAAATCTAAAACCAGTATATATATATCTTAA
TTTAACTACAGCAAATATTCAAATGCAAATATTATATAAAAAAGTTAATGTCAAGAGTTT
GTAGAGTTGTAATGGCTGGTAACTTAATTGAAAAGAATAAAGATTTAGATTATAATTTAG
TTGGTTCATATCGTATGCAGGAATAATTTAAATAACTTTATGCAGAAATTGCTAAAAAGA
TGCATGATGTAGATAAAAATATTAATGAAATTGCTGGAAATGTTTGTTTAGATATTATGC
CAGGAGATAAAGATCCTGCATAAGCATTTTTACCTTAACAATCCTTGAATAAGTGTTATT
TTGCATCATCCAAATCTATTCCAACACTTAATCTTGTTTCTAATCCTTATAAATTTGAAT
AAGAAAATATTTAAATATTAGGTGTATCAGGTAATATTTGCATTTTCATCAAATTTCATT
TGAAAATAAAATAATAAAATTTAAGTTTTTTATACAAATCCATTAATTAAATTCTAAAAG
TGTTAAAATTTTCATAAAAAAAATAATTTTTATTCAAAATTAATTTATAAATATTTAGGA
TAGAGTATGCTTGACATTAAAAAATATAGCAATTACAGCGATTAGGATATAGACATACTA
TAATCACATTTACTATGGAGACATATTTCACCTACTTCTCCTGATACTTTATAGTAAAAA
TATTTTTTTATTTTACTTTATTTAACTAAATTAAAATATTTGTTATAGATGTTTCCCATT
CCATGAAAGTGATCCTTTTATTTTAGATGAGCTTCCTCATGTTTATTTTAGTGGAAATAG
TCCTAAATTTGAAACAAAAATGGTATATGAAGAGAACACTAAAAAGAGATGTAGATTAAT
TTGTGTCCCTGCTTTATCTGCTAGTAATTCTTTTGTAATAATGAATCTAGCTAACTTAGA
TACATTTGAAATTAAATTATGA