Identifiers and Description

Gene Model Identifier

TTHERM_00112520

Standard Name

POL2 (DNA polymerase epsilon catalytic subunit POL2)

Aliases

PreTt27066 | 8.m00326 | 3812.m02363

Description

DNA polymerase family B, exonuclease domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00112520

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_99960
WormBaseWBGene000093689.997093137033517e-262DNA polymerase status:Partia
lly_confirmed UniProt:O62218
protein_id:CAB04263.1
Tetrahymena borealisEI9_03963.19.997093137033517e-262DNA polymerase family B, exonu
clease domain-containing prote
in (2309 aa)
DictyBaseDDB_G02831899.997093137033517e-262DDB_G0283189 on chromosome: 4
position 385928 to 393596
OxytrichaContig1027.0.g889.997093137033517e-262Domain of unknown function (DU
F1744)
SGDYNL262W9.997093137033517e-262POL2 Catalytic subunit of DNA
polymerase (II) epsilon, a chr
omosomal DNA replication polym
erase that exhibits processivi
ty and proofreading exonucleas
e activity; also involved in D
NA synthesis during DNA repair
; interacts extensively with M
rc1p

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00112520(coding)
ATGCAAAAAGGAGAAAAGTAAAGGATTTAGGAAATAGTTGATTAGAAATTCGGCATTGAA
ACAGTCAAGGATGGGCCTGATCGGTTAGGTTTTATAGCAAATTTTAAGACTGCCTCCATT
GTAGATGAAGATATGAATGAGAGATCAGTTTTATAGATTTACTATGTAGAAGACAATGGC
AATTGGTGCAAGAGTACAATACTCTATTAGCCTTATTTTTATGTAGCTTGTGAGCGTAAT
TTAGAAAAAGAAATAGCATTCTTCTTGGAAAAGAAGTTTGAGAACAAAATTTCAAAAGTG
GAAATAGTAGAAAAAATAGATTTAGAGTAAATAAACCATTTGTCTGGAAAGAAAAAGAAG
TACATCAAAATATCTTTTAAAACTATTCAAGATTTATTAGGTGTAAGAGGGTAGCTTAAG
CCTAAGATTGATAAGAAAAAATAATAAGATTAGAATTCTTTATCTATTTATAGCAATAAT
TTTAATGGGCATATGAGTAGCACAATAACAGATTTCAATAAATTGGATTTGTTAGAATAT
ATTTCAGATATTAGAGAATATGATGTACCCTATCATTCTCGTGTCTGTATTGATTTGAAT
ATAAGAGCTGGTAAATGGTTTAAAATATCCTTCAAAGACAATTTAGTAGATAAAATTGTT
TGTATGGAAGATATAGTGGAAAGACCAGATTTAAAATATTTAGCGTTTGATATTGAAACA
AGTAAAGCAGAATTAAGATTTCCTGATGCCAAAACAGATTGTGTAATGATGATTTCCTTA
ATGTACGAAGGTGATGCTTACTTAATTGTAAATAGAGATTTTTGTGGTTAGGATGTTGTA
GGATTTGATTATGCTCCTACTCCTGAGTTTGAGTGTTCTATTACAGTTTATAATGAACCA
AATGAAAAAGCTTGCATCAAAAAATTCTTTGATATTATAGTAGACTACAAAGCATTTATC
ATTACAAGTTTTAACGGTGACAAATTCGATTGGCCTTTTATTCATGAAAGATGTAACTAA
CTTGGTCTCTCATTAGAAAAGGAAATAGGTATCCATTTAGAAGAAGGTCCAGAATATTTT
GGAAGATATCTCACACATCTTGATTGTTTGTATTGGGTTATAAGAGATGCTTATTTACCT
TAAGGAAGTCACGGTTTGAAGGCTGTAACAAGATCTAAGCTCGGTTATGAGCCTATTGAA
GTAGATCCTGAGGAAATGGTTCCTCTAGCAAGAAATAATACTCAGGAATTAGCTGAATAT
TCAGTTTCTGATGCTGTTGCTACTTATTTTATATATAAAAAGCATATTCATGATTTTATT
TTTGCTTTGTGCACAATTATTCCTTGTTATTCAGATGAAGTTTTGAGAAAGGGTTCAGGT
ACCTTGTGTGAAAATTTGTTAATGACAGAAGCATTTAACAGAAATATAATTTTTCCAAAT
AAAAAAATGGAAGAAAAAGAAAAAATGCATAAAGGACATTGGTTAGATTCTGAGACATAT
ATTGGTGGTAAAGTAGAATGCTTAAAGAGTGGTGTATTCAGATCAGACATTAAATCAAAG
TTTAAGTTTGAAAAAAATGCTTTCCAGACACTGATTGATAACATTGATAAATTATTAGAC
TTCGTTGTTAGAATTGAACAAAATAAAGAAGTAAAAGATGTTGATGGATATGAATAGCTA
AGAGCTTCAGTTGTTCAAAAATTAGAGTTTTTAAGAGATGTGCCAAATCCTAATTGCCAT
GATGCCTTCCCACTTATTTATCACTTGGATGTCGCTGCTATGTATCCTAATATTATTTTA
ACAAATAGACTCTAGCCTGTAGCAATTGTAAATGAATAAATATGCTCAGGATGCTTATTT
AATAGTGCATAAAATGAATGCAAGAGACCTTTAGATTGGTAATGGAGGGGAGAGTATTTT
CCTCTCAATAGAAATGAATTTGAAAAATTGAAGAGCGATCTAGAATATGAAAGAGCTGCA
AATGATTAGCATTAAAATAACACAGAAGAATTTTATAAAGCCTTAAAACAAAGAGTCAAA
ACTTACAGCTAAAAGACATATAAGACAATTCATGTAAAAGAAACTTTAACAAAACAGAAT
ACTGTTTGTATGCGTGAAAATTCCTTCTATATTGACACCGTTAAAGCTTTCCGTGATCGT
AGATATACATTCAAGCATTTGGTTAAGGTTTGGAAAGGCAAAGCTGATGAGGCTTCTAAA
AAAGGTGATGCAGTTGGAAAGAAAGAAGCAAATTTAATGGAGGCTTTATATGAGTCTATG
TAACTAGCTCACAAAATTATTTTGAATAGTTTTTACGGTTATGTCATGCGTAAAGGCGCT
AGATGGTATTCGATGGAAATGGCTGCTATGGTCACTCATATTGGTTCTAGTATTATATCA
GATGCTAAAGCATTTGTAGATTGTGTTGGAATTCCTCTTGAACTAGATACAGATGGTATT
TGGTGTTTGCTACCAGAAGGTTTCCCTGAAGATTTCTTTATTAAGTTTAAGGATGGTAAA
AAAGCTAGAATGGACTACCCTTGCTCTATTTTGAATTACTTGGTTTATGAAAAATACTGT
AACCGTTAATATTAGACCTTAGTTGACCCTGCAAATCTAAAATATTAGACAAACCTAGAA
ATGTCTATCTTTTTTGAACTTGATGGTCCTTATAGAGCTATGATTATTCCAGCTGCTAGG
GAAGAAGGTAAGCTGCTTAAAAAGCGTTATGTTGTCTTCAACAAGAGTGGAAAACTAACA
GAATTAAAAGGGTTTGAAATTAAGCGTAGAGGTGAGTTAAATATTATCAAAATATTCTAA
TCAGAAATTTTCAGCTAGTTTTTAGCTGGTAAAGATTTAAAGGAATGTTATGAAGCTTGT
GCTAAAGTTGCTAAAAAATGGCTTAATCTTCTCAAAAATAGGGGAGAAGGCTTGAATAAC
GAAGAGCTGATTGACTATATTGGTGAAAGTAAAGTTCTTTCTAAGGAGTTAGCTGAGTAC
GGAGAATAAAAGGGTGTTGGTATTACATGTGCTAAGAGATTAAAAGAATTATTGGGGCCA
GATATTGTTAAGGGTAAAAGTTTGTGCTGTAATTATGTTATGAGTAAGAAACCATAAGAA
GCAAGCAAAGCTGAAAGAGCCATACCCATATAAATATTCAATTCAGATCCTACAATAAAA
AAGAAATTCTTACGTAAATGGTTAAAAGATAATACCCTTGATGATAAGTAACTAGAAATG
AGAGAAATACTTGATTGGGATTATTATATTGAAAGATTAAGTAACACAATCTAAAAAATC
ATCATTATTCCAGCTGCCACATAAGGTGTTTTTAATATTTTACCTGATGTCTCTGTTCCC
GATTGGCTCACTAAATAAATTAAAGAGCAAGAAGATAAATTTTAATAGCAGAAACTACAA
TTTAAGAATTTTAAAATTCCTTCTTAATAACCTTAAAGTATAATGCAAGCTCTTCACAAC
TAATAATAAATGAAACTTGTAGGCATGTCTGAAGATTAATAAAAGCCAACATAAAAATCT
TCTACAAATAAGGCATTCACTCATACCACAAAAGTAGTTTAAAAACCAAAAAAATTTGTG
AATCCATACAATATGAATACTCAATTCAAAGACTTCTTATAAGCCTAGAAACAACACTGG
ATAGAGTTAAAAAAATACATGCAAGATTTTAGTTATGCTTAGAATATTTCTACATTGAGG
TAAATGTTTTCTAATCAAGATGAATTCATTCTCAAATCTGACTGGCATGTTCTTTAAATA
GCACCCACAGATTAGTTAGGTGTTTATAAATTATGGGCTTTCGTGATTGAAACAAAGTAA
ATTATATCTGTTTCAGTAGAAATTCCTAGAGTCATTTATGTGAATAGTTTGGTTGAATAC
TAAGCTGATGAACAATTTAAGTTAGTGAAAAAGAAACTTCCAAGAGAAAAAAGAGCTTAT
TATCTTTACGAAATTAGTAAGAAAGAAGAAGAATTTCACTCTCAATTTAAAGACTTTGAG
TACTTCCTTTCAAACCCTGAAATCGAAAATATTTATGAATACCATTAGCCTTTAGATTTT
AAATTTATTGTCTAAATAGGAAATGTTGTTAAAATAAATTAAAAATCTATACCAAGAGGG
ACATCTTATTCAAATTATGTTTTTAAATTAGAATAATTTGCAGGTTAATTTGGTGACTCT
AAAACTTATTTAGAAGGTATGGAAATTTCTAATTCTGTTATATATATTGGCGAGTTAAAG
ATGAAGGACAGAAAACTTTGGTGTATACTGAATGCTTAAATATCTGAATACATTTTTATT
ATGGTACATAAGACTGTTGATAAAAATAAATATTCTAAAATAATCAGAGAGTCGTTGCCT
GAGAATTTAGTTAATCCCTAAATGAAGATATAAACATATAATTTTGATGTGAATGATAAA
GCATTTATTTTTATAGAAAATTACCTTCAAGAAATTAAATCTAAGAAAGTCCATGGTATC
ATTTTATTCTAGACTTCTTATACTTTGCAGAATTTAAGAGCTTAAGGCATAAAATCTATA
TTTACTGAATATCCTTGTGCATAGCTTCCTCATTTAAAAATGGATGAATCACTTTATAGT
TCTTTAGATTGGCAACAAAAAGGTATGAGATTCTTATGTCAGTAAATTGAAAATGTTTAA
TAGAATCTTGAAAATGCTTACAGATTAACTGAGTACGTTTAAGTACCCATATGCAATTTA
AACTTTGAAAATTCATTTAGCCAATTAACTGATATTTACTTTGGTCGTTTGCTTAGAAAT
GATAATTGTATTTCTTGGTATGGTAGCTACATAAATAATAAAGAATAGGAATACAGACAG
CTTATTCCTTCAGATTTCTTGAGAAACGAAATATCTTTTAGCGGTTTGTATACTTCACAT
ACCGTCGAAATTGATATTGGTTTGCTCGCTCTCAACACTATTGCTCATGCTGATGAATTA
AAGAATATTGATAAAGAAGCTAGTAAGCTCATAGATTATTCAAGGGTAAATAATAAGTAA
AACAAAAACAAAAAAGGAGTTTAGTATTAACAATAAGATCATGAAGAAATAGATGAGTTA
ACTCAAGCAAAGCAATCCTTTAAGAATCTTTAGTAAATGGTATAATACTGGATACATGAT
GTATAGCAATTTGAGAATCCTATTGCAGATTTTTTCATTACCAATATTCACTCATGGCTA
ACAACAAAAGAGTCTAAATTTTATGATCCTATTCTCTCAAAAATGCTTCAAAAACTCATG
AAGAAAATTTTCTAATATTTTATTTCTAAACTAAGAGGTCTAGGTGCTAAAATTGTTCAT
TCTACAATGAATAAGATTATTCTTGATACTGGCAAAAATACTTTAAATGAAGCTAAAAGC
TATACTCAATATATCCTCCAAACTGTGCTTGGCTAGCCTCTCTTTAAGGTGCTGACTTTA
ACACCATAAAGATATTTCAAGATTTTACTTTTTAAAGATTCCCATAATTACATGGCTCTG
TAAGAGTTTGACAGTAGTAATGAAGAAAAAGAAACAGGCTAACCTAATTAAACATAGCAT
TCTGTTATTTCTAATTGGCATATTTCAGATTTTTTACCACCAAAATTAAAACACTATTTC
CAACTTGTTGTTTTAGAATATTTGTATAAAATAACTCAATAAAAAGCTGAATTAGCAACA
AATCCTGAATATGCTAATACACTAGTTGAGGAAATCGAATCATTCTGCAAAAAGTATATT
TCGGTTAATCTATCAGATAAACTATTAGACGCTATTCCAGAATTGGAAACATAATATAGA
AGAGATAGATAGCAAATAGAAAAACTAACTTAAAAATAAGAAGAATACATATACCTTGAA
AGCTAAATTATTGAATAACAAAAGAAATTGAAAAAATCTTAAATAGAAAATAATTACCAT
TAAGATTTTGATATGGACGCAGATTACTATGATTAAATTTAGCAAGAAAAAGAAGAATAG
CAATACAAAAAAAAGATTCAGAACTAAAAAGAAAATAATAATAATACTAAGCAATCTTAA
AAAGCAATGGTAAACGAAGAGGATGATTAATATGAAAACTAACTTGTAGATTATGAAGAA
ATAGAAAATGAGTAAGAAGATTTAGATGATTTTATAGTTTCTTAAAATGAGCAAGAAGCT
GATAATTATTATTCTGAGTAAGAAGATGGTGATGATTTAAATGATTCTTTCGTTGTTGAT
GATGTAAAGGATGCTCTTTATGCAGACATCCCAGCAACATAGGATGAACTTTCTAAGCTT
AAAAGGATAATGAAGAGAGATTAAAAAAAATTAGATGAGCTAAATAATTTATGGAGTTTT
CCATAGCTTCTTGGTGGTAGAGTTAAATATGATAACTCTATATTAGAATTTGTAAACTTT
TTGATGCATGTGTTTAGCCTGGATTAGAATGTTAAAGATGAATTAATTTAGGTTAAGAGA
GATTGCTTGAAATTCCTTAAAATGAATGATTTTTCAAATGAAGCTTAATTTAAAGAGCCC
TGTGTTATCATAAAAGCAGCTGATATAGTATGCAAGAGTTGTCTCTAAGTATGTGAGCTA
GACATATTCAGAGATGATTGGATCTGTCAAGAATGCAGAACCCCTTATGATTTACATTAT
CTTGAAAATAAATTTATAGAACTAATTAAAAACTCATTAACTTTCTATTAGTTCCAAGAT
ATATATTGTAAGAAATGTAAAATGATAAAAGAAGACCTTTTGAGTAATCTTTGCAAATGC
TCAGGTTCATACTTCTTCTAAATTGATGAAAATATTTTACCAATAATTGGTCCTGATTCT
AAAAAAATAAGAAGAGCCTTTACAGAGCTTGCCCAAACTAACAATTTCAATACTCTCTTA
CAAATGATTTAATAGACATGGATTATTTGA


>TTHERM_00112520(protein)
MQKGEKQRIQEIVDQKFGIETVKDGPDRLGFIANFKTASIVDEDMNERSVLQIYYVEDNG
NWCKSTILYQPYFYVACERNLEKEIAFFLEKKFENKISKVEIVEKIDLEQINHLSGKKKK
YIKISFKTIQDLLGVRGQLKPKIDKKKQQDQNSLSIYSNNFNGHMSSTITDFNKLDLLEY
ISDIREYDVPYHSRVCIDLNIRAGKWFKISFKDNLVDKIVCMEDIVERPDLKYLAFDIET
SKAELRFPDAKTDCVMMISLMYEGDAYLIVNRDFCGQDVVGFDYAPTPEFECSITVYNEP
NEKACIKKFFDIIVDYKAFIITSFNGDKFDWPFIHERCNQLGLSLEKEIGIHLEEGPEYF
GRYLTHLDCLYWVIRDAYLPQGSHGLKAVTRSKLGYEPIEVDPEEMVPLARNNTQELAEY
SVSDAVATYFIYKKHIHDFIFALCTIIPCYSDEVLRKGSGTLCENLLMTEAFNRNIIFPN
KKMEEKEKMHKGHWLDSETYIGGKVECLKSGVFRSDIKSKFKFEKNAFQTLIDNIDKLLD
FVVRIEQNKEVKDVDGYEQLRASVVQKLEFLRDVPNPNCHDAFPLIYHLDVAAMYPNIIL
TNRLQPVAIVNEQICSGCLFNSAQNECKRPLDWQWRGEYFPLNRNEFEKLKSDLEYERAA
NDQHQNNTEEFYKALKQRVKTYSQKTYKTIHVKETLTKQNTVCMRENSFYIDTVKAFRDR
RYTFKHLVKVWKGKADEASKKGDAVGKKEANLMEALYESMQLAHKIILNSFYGYVMRKGA
RWYSMEMAAMVTHIGSSIISDAKAFVDCVGIPLELDTDGIWCLLPEGFPEDFFIKFKDGK
KARMDYPCSILNYLVYEKYCNRQYQTLVDPANLKYQTNLEMSIFFELDGPYRAMIIPAAR
EEGKLLKKRYVVFNKSGKLTELKGFEIKRRGELNIIKIFQSEIFSQFLAGKDLKECYEAC
AKVAKKWLNLLKNRGEGLNNEELIDYIGESKVLSKELAEYGEQKGVGITCAKRLKELLGP
DIVKGKSLCCNYVMSKKPQEASKAERAIPIQIFNSDPTIKKKFLRKWLKDNTLDDKQLEM
REILDWDYYIERLSNTIQKIIIIPAATQGVFNILPDVSVPDWLTKQIKEQEDKFQQQKLQ
FKNFKIPSQQPQSIMQALHNQQQMKLVGMSEDQQKPTQKSSTNKAFTHTTKVVQKPKKFV
NPYNMNTQFKDFLQAQKQHWIELKKYMQDFSYAQNISTLRQMFSNQDEFILKSDWHVLQI
APTDQLGVYKLWAFVIETKQIISVSVEIPRVIYVNSLVEYQADEQFKLVKKKLPREKRAY
YLYEISKKEEEFHSQFKDFEYFLSNPEIENIYEYHQPLDFKFIVQIGNVVKINQKSIPRG
TSYSNYVFKLEQFAGQFGDSKTYLEGMEISNSVIYIGELKMKDRKLWCILNAQISEYIFI
MVHKTVDKNKYSKIIRESLPENLVNPQMKIQTYNFDVNDKAFIFIENYLQEIKSKKVHGI
ILFQTSYTLQNLRAQGIKSIFTEYPCAQLPHLKMDESLYSSLDWQQKGMRFLCQQIENVQ
QNLENAYRLTEYVQVPICNLNFENSFSQLTDIYFGRLLRNDNCISWYGSYINNKEQEYRQ
LIPSDFLRNEISFSGLYTSHTVEIDIGLLALNTIAHADELKNIDKEASKLIDYSRVNNKQ
NKNKKGVQYQQQDHEEIDELTQAKQSFKNLQQMVQYWIHDVQQFENPIADFFITNIHSWL
TTKESKFYDPILSKMLQKLMKKIFQYFISKLRGLGAKIVHSTMNKIILDTGKNTLNEAKS
YTQYILQTVLGQPLFKVLTLTPQRYFKILLFKDSHNYMALQEFDSSNEEKETGQPNQTQH
SVISNWHISDFLPPKLKHYFQLVVLEYLYKITQQKAELATNPEYANTLVEEIESFCKKYI
SVNLSDKLLDAIPELETQYRRDRQQIEKLTQKQEEYIYLESQIIEQQKKLKKSQIENNYH
QDFDMDADYYDQIQQEKEEQQYKKKIQNQKENNNNTKQSQKAMVNEEDDQYENQLVDYEE
IENEQEDLDDFIVSQNEQEADNYYSEQEDGDDLNDSFVVDDVKDALYADIPATQDELSKL
KRIMKRDQKKLDELNNLWSFPQLLGGRVKYDNSILEFVNFLMHVFSLDQNVKDELIQVKR
DCLKFLKMNDFSNEAQFKEPCVIIKAADIVCKSCLQVCELDIFRDDWICQECRTPYDLHY
LENKFIELIKNSLTFYQFQDIYCKKCKMIKEDLLSNLCKCSGSYFFQIDENILPIIGPDS
KKIRRAFTELAQTNNFNTLLQMIQQTWII


>TTHERM_00112520(gene)
ATGCAAAAAGGAGAAAAGTAAAGGATTTAGGAAATAGTTGATTAGAAATTCGGCATTGAA
ACAGTCAAGGATGGGCCTGATCGGTTAGGTTTTATAGCAAATTTTAAGACTGCCTCCATT
GTAGATGAAGATATGAATGAGAGATCAGTTTTATAGATTTACTATGTAGAAGACAATGGC
AATTGGTGCAAGAGTACAATACTCTATTAGCCTTATTTTTATGTAGCTTGTGAGCGTAAT
TTAGAAAAAGAAATAGCATTCTTCTTGGAAAAGAAGTTTGAGAACAAAATTTCAAAAGTG
GAAATAGTAGAAAAAATAGATTTAGAGTAAATAAACCATTTGTCTGGAAAGAAAAAGAAG
TACATCAAAATATCTTTTAAAACTATTCAAGATTTATTAGGTGTAAGAGGGTAGCTTAAG
CCTAAGATTGATAAGAAAAAATAATAAGATTAGAATTCTTTATCTATTTATAGCAATAAT
TTTAATGGGCATATGAGTAGCACAATAACAGATTTCAATAAATTGGATTTGTTAGAATAT
ATTTCAGATATTAGAGAATATGATGTACCCTATCATTCTCGTGTCTGTATTGATTTGAAT
ATAAGAGCTGGTAAATGGTAATATCAAATTTTTATACTATCACAATTAATCTAAATTTTA
AAATCATTTCAAGTAAGATATTTCATATAAATAAATTTCTTTTTAAAATACAACAAACAG
GTTTAAAATATCCTTCAAAGACAATTTAGTAGATAAAATTGTTTGTATGGAAGATATAGT
GGAAAGACCAGATTTAAAATATTTAGCGTTTGATATTGAAACAAGTAAAGCAGAATTAAG
ATTTCCTGATGCCAAAACAGATTGTGTAATGATGATTTCCTTAATGTACGAAGGTGATGC
TTACTTAATTGTAAATAGAGATTTTTGTGGTTAGGATGTTGTAGGATTTGATTATGCTCC
TACTCCTGAGTTTGAGTGTTCTATTACAGTTTATAATGAACCAAATGAAAAAGCTTGCAT
CAAAAAATTCTTTGATATTATAGTAGACTACAAAGCATTTATCATTACAAGTTTTAACGG
TGACAAATTCGATTGGCCTTTTATTCATGAAAGATGTAACTAACTTGGTCTCTCATTAGA
AAAGGAAATAGGTATCCATTTAGAAGAAGGTCCAGAATATTTTGGAAGATATCTCACACA
TCTTGATTGTTTGTATTGGGTTATAAGAGATGCTTATTTACCTTAAGGAAGGTAAGCTTT
ATAAAAGATTATTTTATTTGTTTTATAAAAATTATTCTGAAATAAAATCATTTCCAAATT
TTTTAATTTATTTTTAAATATCAATCAATTAGTCACGGTTTGAAGGCTGTAACAAGATCT
AAGCTCGGTTATGAGCCTATTGAAGTAGATCCTGAGGAAATGGTTCCTCTAGCAAGAAAT
AATACTCAGGAATTAGCTGAATATTCAGTTTCTGATGCTGTTGCTACTTATTTTATATAT
AAAAAGCATATTCATGATTTTATTTTTGCTTTGTGCACAATTATTCCTTGTTATTCAGAT
GAAGTTTTGAGAAAGGGTTCAGGTACCTTGTGTGAAAATTTGTTAATGACAGAAGCATTT
AACAGAAATATAATTTTTCCAAATAAAAAAATGGAAGAAAAAGAAAAAATGCATAAAGGA
CATTGGTTAGATTCTGAGACATATATTGGTATTTATATTATTGAGTGACAAATATTAAAA
ATTTTTAATAAAAAAAAAACTTAGGTGGTAAAGTAGAATGCTTAAAGAGTGGTGTATTCA
GATCAGACATTAAATCAAAGTTTAAGTTTGAAAAAAATGCTTTCCAGACACTGATTGATA
ACATTGATAAATTATTAGACTTCGTTGTTAGAATTGAACAAAATAAAGAAGTAAAAGATG
TTGATGGATATGAATAGCTAAGAGCTTCAGTTGTTCAAAAATTAGAGTTTTTAAGAGATG
TGCCAAATCCTAATTGCCATGATGCCTTCCCACTTATTTATCACTTGGATGTCGCTGCTA
TGTATCCTAATATTATTTTAACAAATAGACTCTAGCCTGTAGCAATTGTAAATGAATAAA
TATGCTCAGGATGCTTATTTAATAGTGCATAAAATGAATGCAAGAGACCTTTAGATTGGT
AATGGAGGGGAGAGTATTTTCCTCTCAATAGAAATGAATTTGAAAAATTGAAGAGCGATC
TAGAATATGAAAGAGCTGCAAATGTAATAAATAATTTTAATTTTAAAATATTGTGTTACA
AGCCTTTCTTTTTTTGATAAATTTAGGATTAGCATTAAAATAACACAGAAGAATTTTATA
AAGCCTTAAAACAAAGAGTCAAAACTTACAGCTAAAAGACATATAAGACAATTCATGTAA
AAGAAACTTTAACAAAACAGAATACTGTTTGTATGCGTGAAAATTCCTTCTATATTGACA
CCGTTAAAGCTTTCCGTATGCATTTATTTAAAGCTAATACTTTTATTTCTATTGATTTTT
TAGTAATAAATAAATGAAATTTGAATTCTATTTTGAAGATGATTTAATTTCAATAGAATT
TATGATTGTTTAAATATTTTTAATTTAATAAAAATTAATTTAGGTGATCGTAGATATACA
TTCAAGCATTTGGTTAAGGTTTGGAAAGGCAAAGCTGATGAGGCTTCTAAAAAAGGTGAT
GCAGTTGGAAAGAAAGAAGCAAATTTAATGGAGGCTTTATATGAGTCTATGTAACTAGCT
CACAAAATTATTTTGAATAGTTTTTACGGTTATGTCATGCGTAAAGGCGCTAGATGGTAT
TCGATGGAAATGGCTGCTATGGTCACTCATATTGGTTCTAGTATTATATCAGATGCTAAA
GCATTTGTAGATTGTGTTGGAATTCCTCTTGAACTAGATACAGATGGTATTTGGTGTTTG
CTACCAGAAGGTTTCCCTGAAGATTTCTTTATTAAGTTTAAGGATGGTAAAAAAGCTAGA
ATGGACTACCCTTGCTCTATTTTGAATTACTTGGTTTATGAAAAATACTGTAACCGTTAA
TATTAGACCTTAGTTGACCCTGCAAATCTAAAATATTAGACAAACCTAGAAATGTCTATC
TTTTTTGAACTTGATGGTCCTTATAGAGCTATGATTATTCCAGCTGCTAGGGAAGAAGGT
ATTACAAATGAATTATAAATATTAAATTAATTGTTTTTTAAATTACAAGGTAAGCTGCTT
AAAAAGCGTTATGTTGTCTTCAACAAGAGTGGAAAACTAACAGAATTAAAAGGGTTTGAA
ATTAAGCGTAGAGGTGAGTTAAATATTATCAAAATATTCTAATCAGAAATTTTCAGCTAG
TTTTTAGCTGGTAAAGATTTAAAGGAATGTTATGAAGCTTGTGCTAAAGTTGCTAAAAAA
TGGCTTAATCTTCTCAAAAATAGGGTAATTTTTTGAATTTTAATTTCTAAAATTAAAAAA
AAATTTTAATCTCAGGGAGAAGGCTTGAATAACGAAGAGCTGATTGACTATATTGGTGAA
AGTAAAGTTCTTTCTAAGGAGTTAGCTGAGTACGGAGAATAAAAGGGTGTTGGTATTACA
TGTGCTAAGAGATTAAAAGAATTATTGGGGCCAGATATTGTTAAGGGTAAAAGTTTGTGC
TGTAATTATGTTATGAGTAAGAAACCATAAGAAGCAAGCAAAGCTGAAAGAGCCATACCC
ATATAAATATTCAATTCAGATCCTACAATAAAAAAGAAATTCTTACGTAAATGGTTAAAA
GATAATACCCTTGATGATAAGTAACTAGAAATGAGAGAAATACTTGATTGGGATTATTAT
ATTGAAAGATTAAGTAACACAATCTAAAAAATCATCATTATTCCAGCTGCCACATAAGGT
GTTTTTAATATTTTACCTGATGTCTCTGTTCCCGATTGGCTCACTAAATAAATTAAAGAG
CAAGAAGATAAATTTTAATAGCAGAAACTACAATTTAAGAATTTTAAAATTCCTTCTTAA
TAACCTTAAAGTATAATGCAAGCTCTTCACAACTAATAATAAATGAAACTTGTAGGCATG
TCTGAAGATTAATAAAAGCCAACATAAAAATCTTCTACAAATAAGGCATTCACTCATACC
ACAAAAGTAGTTTAAAAACCAAAAAAATTTGTGAATCCATACAATATGAATACTCAATTC
AAAGACTTCTTATAAGCCTAGAAACAACACTGGATAGAGTTAAAAAAATACATGCAAGAT
TTTAGTTATGCTTAGAATATTTCTACATTGAGGTAAATGTTTTCTAATCAAGATGAATTC
ATTCTCAAATCTGACTGGCATGTTCTTTAAATAGCACCCACAGATTAGTTAGGTATTTAA
AAAAACTATAATTACTCTATTTAATTAATATTTCTTTTATTTATTTTAGGTGTTTATAAA
TTATGGGCTTTCGTGATTGAAACAAAGTAAATTATATCTGTTTCAGTAGAAATTCCTAGA
GTCATTTATGTGAATAGTTTGGTTGAATACTAAGCTGATGAACAATTTAAGTTAGTGAAA
AAGAAACTTCCAAGAGAAAAAAGAGCTTATTATCTTTACGAAATTAGTAAGAAAGAAGAA
GAATTTCACTCTCAATTTAAAGACTTTGAGTACTTCCTTTCAAACCCTGAAATCGAAAAT
ATTTATGAATACCATTAGCCTTTAGATTTTAAATTTATTGTCTAAATAGGAAATGTTGTT
AAAATAAATTAAAAATCTATACCAAGAGGGACATCTTATTCAAATTATGTTTTTAAATTA
GAATAATTTGCAGGTAAAAATATTATTTATTGATAGATTAATAAATATAAAAATTCTTAA
TTTTCTTTTTAAAGGTTAATTTGGTGACTCTAAAACTTATTTAGAAGGTATGGAAATTTC
TAATTCTGTTATATATATTGGCGAGTTAAAGATGAAGGACAGAAAACTTTGGTGTATACT
GAATGCTTAAATATCTGAATACATTTTTATTATGGTACATAAGACTGTTGATAAAAATAA
ATATTCTAAAATAATCAGAGAGTCGTTGCCTGAGAATTTAGTTAATCCCTAAATGAAGAT
ATAAACATATAATTTTGATGTGAATGATAAAGCATTTATTTTTATAGAAAATTACCTTCA
AGAAATTAAATCTAAGAAAGTAAATATTATTTATTAAATAATTAGCTATGAAATTTATTT
AAAAAAATCATTTAAAAAACAGGTCCATGGTATCATTTTATTCTAGACTTCTTATACTTT
GCAGAATTTAAGAGCTTAAGGCATAAAATCTATATTTACTGAATATCCTTGTGCATAGCT
TCCTCATTTAAAAATGGATGAATCACTTTATAGTTCTTTAGATTGGCAACAAAAAGGTAT
GAGATTCTTATGTCAGTAAATTGAAAATGTTTAATAGAATCTTGAAAATGCTTACAGATT
AACTGAGTACGTTTAAGTACCCATATGCAATTTAAACTTTGAAAATTCATTTAGCCAATT
AACTGATATTTACTTTGGTCGTTTGCTTAGGTAATTAATTAATTTAACAACTTTATCTTT
TAATAAATATTCTCAAAGTTAATCAATAATAATAAATTATATTTTAGAAATGATAATTGT
ATTTCTTGGTATGGTAGCTACATAAATAATAAAGAATAGGAATACAGACAGCTTATTCCT
TCAGATTTCTTGAGAAACGAAATATCTTTTAGCGGTTTGTATACTTCACATACCGTCGAA
ATTGATATTGGTTTGCTCGCTCTCAACACTATTGCTCATGCTGATGAATTAAAGAATATT
GATAAAGAAGCTAGTAAGCTCATAGATTATTCAAGGGTAAATAATAAGTAAAACAAAAAC
AAAAAAGGAGTTTAGTATTAACAATAAGATCATGAAGAAATAGATGAGTTAACTCAAGCA
AAGCAATCCTTTAAGAATCTTTAGTAAATGGTATAATACTGGATACATGATGTATAGCAA
TTTGAGAATCCTATTGCAGATTTTTTCATTACCAATATTCACTCATGGCTAACAACAAAA
GAGTCTAAATTTTATGATCCTATTCTCTCAAAAATGCTTCAAAAACTCATGAAGAAAATT
TTCTAATATTTTATTTCTAAACTAAGAGGTCTAGGTGCTAAAATTGTTCATTCTACAATG
AATAAGATTATTCTTGATACTGGCAAAAATACTTTAAATGAAGCTAAAAGCTATACTCAA
TATATCCTCCAAACTGTGCTTGGCTAGCCTCTCTTTAAGGTGCTGACTTTAACACCATAA
AGATATTTCAAGATTTTACTTTTTAAAGATTCCCATAATTACATGGCTCTGTAAGAGTTT
GACAGTAGTAATGAAGAAAAAGAAACAGGCTAACCTAATTAAACATAGCATTCTGTTATT
TCTAATTGGCATATTTCAGATTTTTTACCACCAAAATTAAAACACTATTTCCAACTTGTT
GTTTTAGAATATTTGTATAAAATAACTCAATAAAAAGCTGAATTAGCAACAAATCCTGAA
TATGCTAATACACTAGTTGAGGAAATCGAATCATTCTGCAAAAAGTATATTTCGGTTAAT
CTATCAGATAAACTATTAGACGCTATTCCAGAATTGGAAACATAATATAGAAGAGATAGA
TAGCAAATAGAAAAACTAACTTAAAAATAAGAAGAATACATATACCTTGAAAGCTAAATT
ATTGGTAATTAATTTTTCTCATTTTTTTAATAAAACTATTTAGGAAATTATTTTTATTTT
TCGTATTTTGAAATTGTTTTAATAAATTAATTTTATTAATATTAGAATAACAAAAGAAAT
TGAAAAAATCTTAAATAGAAAATAATTACCATTAAGATTTTGATATGGACGCAGATTACT
ATGATTAAATTTAGCAAGAAAAAGAAGAATAGCAATACAAAAAAAAGATTCAGAACTAAA
AAGAAAATAATAATAATACTAAGCAATCTTAAAAAGCAATGGTAAACGAAGAGGATGATT
AATATGAAAACTAACTTGTAGATTATGAAGAAATAGAAAATGAGTAAGAAGATTTAGATG
ATTTTATAGTTTCTTAAAATGAGCAAGAAGCTGATAATTATTATTCTGAGTAAGAAGATG
GTGATGATTTAAATGATTCTTTCGTTGTTGATGATGTAAAGGATGCTCTTTATGCAGACA
TCCCAGCAACATAGGATGAACTTTCTAAGCTTAAAAGGATAATGAAGAGAGATTAAAAAA
AATTAGATGAGCTAAATAATTTATGGAGTTTTCCATAGCTTCTTGGTGGTAGAGTTAAAT
ATGATAACTCTATATTAGAATTTGTAAACTTTTTGATGCATGTGTTTAGCCTGGATTAGA
ATGTTAAAGATGAATTAATTTAGGTTAAGAGAGATTGCTTGAAATTCCTTAAAATGAATG
ATTTTTCAAATGAAGCTTAATTTAAAGAGCCCTGTGTTATCATAAAAGCAGCTGATATAG
TATGCAAGAGTTGTCTCTAAGTATGTGAGCTAGACATATTCAGAGATGATTGGATCTGTC
AAGAATGCAGAACCCCTTATGATTTACATTATCTTGAAAATAAATTTATAGAACTAATTA
AAAACTCATTAACTTTCTATTAGTTCCAAGATATATATTGTAAGAAATGTAAAATGATAA
AAGAAGACCTTTTGAGTAATCTTTGCAAATGCTCAGGTTCATACTTCTTCTAAATTGATG
AAAATATTTTACCAATAATTGGTCCTGATTCTAAAAAAATAAGAAGAGCCTTTACAGAGC
TTGCCCAAACTAACAATTTCAATACTCTCTTACAAATGATTTAATAGACATGGATTATTT
GA