Identifiers and Description

Gene Model Identifier

TTHERM_00112520

Standard Name

POL2 (DNA polymerase epsilon catalytic subunit POL2)

Aliases

PreTt27066 | 8.m00326 | 3812.m02363

Description

POL2 DNA polymerase; DNA polymerase family B- exonuclease domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00112520

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_99960
WormBaseWBGene000093689.997093137033517e-262DNA polymerase status:Partia
lly_confirmed UniProt:O62218
protein_id:CAB04263.1
Tetrahymena borealisEI9_03963.19.997093137033517e-262DNA polymerase family B, exonu
clease domain-containing prote
in (2309 aa)
DictyBaseDDB_G02831899.997093137033517e-262DDB_G0283189 on chromosome: 4
position 385928 to 393596
OxytrichaContig1027.0.g889.997093137033517e-262Domain of unknown function (DU
F1744)
SGDYNL262W9.997093137033517e-262POL2 Catalytic subunit of DNA
polymerase (II) epsilon, a chr
omosomal DNA replication polym
erase that exhibits processivi
ty and proofreading exonucleas
e activity; also involved in D
NA synthesis during DNA repair
; interacts extensively with M
rc1p

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00112520(coding)
ATGCAAAAAGGAGAAAAGTAAAGGATTTAGGAAATAGTTGATTAGAAATTCGGCATTGAA
ACAGTCAAGGATGGGCCTGATCGGTTAGGTTTTATAGCAAATTTTAAGACTGCCTCCATT
GTAGATGAAGATATGAATGAGAGATCAGTTTTATAGATTTACTATGTAGAAGACAATGGC
AATTGGTGCAAGAGTACAATACTCTATTAGCCTTATTTTTATGTAGCTTGTGAGCGTAAT
TTAGAAAAAGAAATAGCATTCTTCTTGGAAAAGAAGTTTGAGAACAAAATTTCAAAAGTG
GAAATAGTAGAAAAAATAGATTTAGAGTAAATAAACCATTTGTCTGGAAAGAAAAAGAAG
TACATCAAAATATCTTTTAAAACTATTCAAGATTTATTAGGTGTAAGAGGGTAGCTTAAG
CCTAAGATTGATAAGAAAAAATAATAAGATTAGAATTCTTTATCTATTTATAGCAATAAT
TTTAATGGGCATATGAGTAGCACAATAACAGATTTCAATAAATTGGATTTGTTAGAATAT
ATTTCAGATATTAGAGAATATGATGTACCCTATCATTCTCGTGTCTGTATTGATTTGAAT
ATAAGAGCTGGTAAATGGTTTAAAATATCCTTCAAAGACAATTTAGTAGATAAAATTGTT
TGTATGGAAGATATAGTGGAAAGACCAGATTTAAAATATTTAGCGTTTGATATTGAAACA
AGTAAAGCAGAATTAAGATTTCCTGATGCCAAAACAGATTGTGTAATGATGATTTCCTTA
ATGTACGAAGGTGATGCTTACTTAATTGTAAATAGAGATTTTTGTGGTTAGGATGTTGTA
GGATTTGATTATGCTCCTACTCCTGAGTTTGAGTGTTCTATTACAGTTTATAATGAACCA
AATGAAAAAGCTTGCATCAAAAAATTCTTTGATATTATAGTAGACTACAAAGCATTTATC
ATTACAAGTTTTAACGGTGACAAATTCGATTGGCCTTTTATTCATGAAAGATGTAACTAA
CTTGGTCTCTCATTAGAAAAGGAAATAGGTATCCATTTAGAAGAAGGTCCAGAATATTTT
GGAAGATATCTCACACATCTTGATTGTTTGTATTGGGTTATAAGAGATGCTTATTTACCT
TAAGGAAGTCACGGTTTGAAGGCTGTAACAAGATCTAAGCTCGGTTATGAGCCTATTGAA
GTAGATCCTGAGGAAATGGTTCCTCTAGCAAGAAATAATACTCAGGAATTAGCTGAATAT
TCAGTTTCTGATGCTGTTGCTACTTATTTTATATATAAAAAGCATATTCATGATTTTATT
TTTGCTTTGTGCACAATTATTCCTTGTTATTCAGATGAAGTTTTGAGAAAGGGTTCAGGT
ACCTTGTGTGAAAATTTGTTAATGACAGAAGCATTTAACAGAAATATAATTTTTCCAAAT
AAAAAAATGGAAGAAAAAGAAAAAATGCATAAAGGACATTGGTTAGATTCTGAGACATAT
ATTGGTGGTAAAGTAGAATGCTTAAAGAGTGGTGTATTCAGATCAGACATTAAATCAAAG
TTTAAGTTTGAAAAAAATGCTTTCCAGACACTGATTGATAACATTGATAAATTATTAGAC
TTCGTTGTTAGAATTGAACAAAATAAAGAAGTAAAAGATGTTGATGGATATGAATAGCTA
AGAGCTTCAGTTGTTCAAAAATTAGAGTTTTTAAGAGATGTGCCAAATCCTAATTGCCAT
GATGCCTTCCCACTTATTTATCACTTGGATGTCGCTGCTATGTATCCTAATATTATTTTA
ACAAATAGACTCTAGCCTGTAGCAATTGTAAATGAATAAATATGCTCAGGATGCTTATTT
AATAGTGCATAAAATGAATGCAAGAGACCTTTAGATTGGTAATGGAGGGGAGAGTATTTT
CCTCTCAATAGAAATGAATTTGAAAAATTGAAGAGCGATCTAGAATATGAAAGAGCTGCA
AATGATTAGCATTAAAATAACACAGAAGAATTTTATAAAGCCTTAAAACAAAGAGTCAAA
ACTTACAGCTAAAAGACATATAAGACAATTCATGTAAAAGAAACTTTAACAAAACAGAAT
ACTGTTTGTATGCGTGAAAATTCCTTCTATATTGACACCGTTAAAGCTTTCCGTGATCGT
AGATATACATTCAAGCATTTGGTTAAGGTTTGGAAAGGCAAAGCTGATGAGGCTTCTAAA
AAAGGTGATGCAGTTGGAAAGAAAGAAGCAAATTTAATGGAGGCTTTATATGAGTCTATG
TAACTAGCTCACAAAATTATTTTGAATAGTTTTTACGGTTATGTCATGCGTAAAGGCGCT
AGATGGTATTCGATGGAAATGGCTGCTATGGTCACTCATATTGGTTCTAGTATTATATCA
GATGCTAAAGCATTTGTAGATTGTGTTGGAATTCCTCTTGAACTAGATACAGATGGTATT
TGGTGTTTGCTACCAGAAGGTTTCCCTGAAGATTTCTTTATTAAGTTTAAGGATGGTAAA
AAAGCTAGAATGGACTACCCTTGCTCTATTTTGAATTACTTGGTTTATGAAAAATACTGT
AACCGTTAATATTAGACCTTAGTTGACCCTGCAAATCTAAAATATTAGACAAACCTAGAA
ATGTCTATCTTTTTTGAACTTGATGGTCCTTATAGAGCTATGATTATTCCAGCTGCTAGG
GAAGAAGGTAAGCTGCTTAAAAAGCGTTATGTTGTCTTCAACAAGAGTGGAAAACTAACA
GAATTAAAAGGGTTTGAAATTAAGCGTAGAGGTGAGTTAAATATTATCAAAATATTCTAA
TCAGAAATTTTCAGCTAGTTTTTAGCTGGTAAAGATTTAAAGGAATGTTATGAAGCTTGT
GCTAAAGTTGCTAAAAAATGGCTTAATCTTCTCAAAAATAGGGGAGAAGGCTTGAATAAC
GAAGAGCTGATTGACTATATTGGTGAAAGTAAAGTTCTTTCTAAGGAGTTAGCTGAGTAC
GGAGAATAAAAGGGTGTTGGTATTACATGTGCTAAGAGATTAAAAGAATTATTGGGGCCA
GATATTGTTAAGGGTAAAAGTTTGTGCTGTAATTATGTTATGAGTAAGAAACCATAAGAA
GCAAGCAAAGCTGAAAGAGCCATACCCATATAAATATTCAATTCAGATCCTACAATAAAA
AAGAAATTCTTACGTAAATGGTTAAAAGATAATACCCTTGATGATAAGTAACTAGAAATG
AGAGAAATACTTGATTGGGATTATTATATTGAAAGATTAAGTAACACAATCTAAAAAATC
ATCATTATTCCAGCTGCCACATAAGGTGTTTTTAATATTTTACCTGATGTCTCTGTTCCC
GATTGGCTCACTAAATAAATTAAAGAGCAAGAAGATAAATTTTAATAGCAGAAACTACAA
TTTAAGAATTTTAAAATTCCTTCTTAATAACCTTAAAGTATAATGCAAGCTCTTCACAAC
TAATAATAAATGAAACTTGTAGGCATGTCTGAAGATTAATAAAAGCCAACATAAAAATCT
TCTACAAATAAGGCATTCACTCATACCACAAAAGTAGTTTAAAAACCAAAAAAATTTGTG
AATCCATACAATATGAATACTCAATTCAAAGACTTCTTATAAGCCTAGAAACAACACTGG
ATAGAGTTAAAAAAATACATGCAAGATTTTAGTTATGCTTAGAATATTTCTACATTGAGG
TAAATGTTTTCTAATCAAGATGAATTCATTCTCAAATCTGACTGGCATGTTCTTTAAATA
GCACCCACAGATTAGTTAGGTGTTTATAAATTATGGGCTTTCGTGATTGAAACAAAGTAA
ATTATATCTGTTTCAGTAGAAATTCCTAGAGTCATTTATGTGAATAGTTTGGTTGAATAC
TAAGCTGATGAACAATTTAAGTTAGTGAAAAAGAAACTTCCAAGAGAAAAAAGAGCTTAT
TATCTTTACGAAATTAGTAAGAAAGAAGAAGAATTTCACTCTCAATTTAAAGACTTTGAG
TACTTCCTTTCAAACCCTGAAATCGAAAATATTTATGAATACCATTAGCCTTTAGATTTT
AAATTTATTGTCTAAATAGGAAATGTTGTTAAAATAAATTAAAAATCTATACCAAGAGGG
ACATCTTATTCAAATTATGTTTTTAAATTAGAATAATTTGCAGGTTAATTTGGTGACTCT
AAAACTTATTTAGAAGGTATGGAAATTTCTAATTCTGTTATATATATTGGCGAGTTAAAG
ATGAAGGACAGAAAACTTTGGTGTATACTGAATGCTTAAATATCTGAATACATTTTTATT
ATGGTACATAAGACTGTTGATAAAAATAAATATTCTAAAATAATCAGAGAGTCGTTGCCT
GAGAATTTAGTTAATCCCTAAATGAAGATATAAACATATAATTTTGATGTGAATGATAAA
GCATTTATTTTTATAGAAAATTACCTTCAAGAAATTAAATCTAAGAAAGTCCATGGTATC
ATTTTATTCTAGACTTCTTATACTTTGCAGAATTTAAGAGCTTAAGGCATAAAATCTATA
TTTACTGAATATCCTTGTGCATAGCTTCCTCATTTAAAAATGGATGAATCACTTTATAGT
TCTTTAGATTGGCAACAAAAAGGTATGAGATTCTTATGTCAGTAAATTGAAAATGTTTAA
TAGAATCTTGAAAATGCTTACAGATTAACTGAGTACGTTTAAGTACCCATATGCAATTTA
AACTTTGAAAATTCATTTAGCCAATTAACTGATATTTACTTTGGTCGTTTGCTTAGAAAT
GATAATTGTATTTCTTGGTATGGTAGCTACATAAATAATAAAGAATAGGAATACAGACAG
CTTATTCCTTCAGATTTCTTGAGAAACGAAATATCTTTTAGCGGTTTGTATACTTCACAT
ACCGTCGAAATTGATATTGGTTTGCTCGCTCTCAACACTATTGCTCATGCTGATGAATTA
AAGAATATTGATAAAGAAGCTAGTAAGCTCATAGATTATTCAAGGGTAAATAATAAGTAA
AACAAAAACAAAAAAGGAGTTTAGTATTAACAATAAGATCATGAAGAAATAGATGAGTTA
ACTCAAGCAAAGCAATCCTTTAAGAATCTTTAGTAAATGGTATAATACTGGATACATGAT
GTATAGCAATTTGAGAATCCTATTGCAGATTTTTTCATTACCAATATTCACTCATGGCTA
ACAACAAAAGAGTCTAAATTTTATGATCCTATTCTCTCAAAAATGCTTCAAAAACTCATG
AAGAAAATTTTCTAATATTTTATTTCTAAACTAAGAGGTCTAGGTGCTAAAATTGTTCAT
TCTACAATGAATAAGATTATTCTTGATACTGGCAAAAATACTTTAAATGAAGCTAAAAGC
TATACTCAATATATCCTCCAAACTGTGCTTGGCTAGCCTCTCTTTAAGGTGCTGACTTTA
ACACCATAAAGATATTTCAAGATTTTACTTTTTAAAGATTCCCATAATTACATGGCTCTG
TAAGAGTTTGACAGTAGTAATGAAGAAAAAGAAACAGGCTAACCTAATTAAACATAGCAT
TCTGTTATTTCTAATTGGCATATTTCAGATTTTTTACCACCAAAATTAAAACACTATTTC
CAACTTGTTGTTTTAGAATATTTGTATAAAATAACTCAATAAAAAGCTGAATTAGCAACA
AATCCTGAATATGCTAATACACTAGTTGAGGAAATCGAATCATTCTGCAAAAAGTATATT
TCGGTTAATCTATCAGATAAACTATTAGACGCTATTCCAGAATTGGAAACATAATATAGA
AGAGATAGATAGCAAATAGAAAAACTAACTTAAAAATAAGAAGAATACATATACCTTGAA
AGCTAAATTATTGAATAACAAAAGAAATTGAAAAAATCTTAAATAGAAAATAATTACCAT
TAAGATTTTGATATGGACGCAGATTACTATGATTAAATTTAGCAAGAAAAAGAAGAATAG
CAATACAAAAAAAAGATTCAGAACTAAAAAGAAAATAATAATAATACTAAGCAATCTTAA
AAAGCAATGGTAAACGAAGAGGATGATTAATATGAAAACTAACTTGTAGATTATGAAGAA
ATAGAAAATGAGTAAGAAGATTTAGATGATTTTATAGTTTCTTAAAATGAGCAAGAAGCT
GATAATTATTATTCTGAGTAAGAAGATGGTGATGATTTAAATGATTCTTTCGTTGTTGAT
GATGTAAAGGATGCTCTTTATGCAGACATCCCAGCAACATAGGATGAACTTTCTAAGCTT
AAAAGGATAATGAAGAGAGATTAAAAAAAATTAGATGAGCTAAATAATTTATGGAGTTTT
CCATAGCTTCTTGGTGGTAGAGTTAAATATGATAACTCTATATTAGAATTTGTAAACTTT
TTGATGCATGTGTTTAGCCTGGATTAGAATGTTAAAGATGAATTAATTTAGGTTAAGAGA
GATTGCTTGAAATTCCTTAAAATGAATGATTTTTCAAATGAAGCTTAATTTAAAGAGCCC
TGTGTTATCATAAAAGCAGCTGATATAGTATGCAAGAGTTGTCTCTAAGTATGTGAGCTA
GACATATTCAGAGATGATTGGATCTGTCAAGAATGCAGAACCCCTTATGATTTACATTAT
CTTGAAAATAAATTTATAGAACTAATTAAAAACTCATTAACTTTCTATTAGTTCCAAGAT
ATATATTGTAAGAAATGTAAAATGATAAAAGAAGACCTTTTGAGTAATCTTTGCAAATGC
TCAGGTTCATACTTCTTCTAAATTGATGAAAATATTTTACCAATAATTGGTCCTGATTCT
AAAAAAATAAGAAGAGCCTTTACAGAGCTTGCCCAAACTAACAATTTCAATACTCTCTTA
CAAATGATTTAATAGACATGGATTATTTGA


>TTHERM_00112520(protein)
MQKGEKQRIQEIVDQKFGIETVKDGPDRLGFIANFKTASIVDEDMNERSVLQIYYVEDNG
NWCKSTILYQPYFYVACERNLEKEIAFFLEKKFENKISKVEIVEKIDLEQINHLSGKKKK
YIKISFKTIQDLLGVRGQLKPKIDKKKQQDQNSLSIYSNNFNGHMSSTITDFNKLDLLEY
ISDIREYDVPYHSRVCIDLNIRAGKWFKISFKDNLVDKIVCMEDIVERPDLKYLAFDIET
SKAELRFPDAKTDCVMMISLMYEGDAYLIVNRDFCGQDVVGFDYAPTPEFECSITVYNEP
NEKACIKKFFDIIVDYKAFIITSFNGDKFDWPFIHERCNQLGLSLEKEIGIHLEEGPEYF
GRYLTHLDCLYWVIRDAYLPQGSHGLKAVTRSKLGYEPIEVDPEEMVPLARNNTQELAEY
SVSDAVATYFIYKKHIHDFIFALCTIIPCYSDEVLRKGSGTLCENLLMTEAFNRNIIFPN
KKMEEKEKMHKGHWLDSETYIGGKVECLKSGVFRSDIKSKFKFEKNAFQTLIDNIDKLLD
FVVRIEQNKEVKDVDGYEQLRASVVQKLEFLRDVPNPNCHDAFPLIYHLDVAAMYPNIIL
TNRLQPVAIVNEQICSGCLFNSAQNECKRPLDWQWRGEYFPLNRNEFEKLKSDLEYERAA
NDQHQNNTEEFYKALKQRVKTYSQKTYKTIHVKETLTKQNTVCMRENSFYIDTVKAFRDR
RYTFKHLVKVWKGKADEASKKGDAVGKKEANLMEALYESMQLAHKIILNSFYGYVMRKGA
RWYSMEMAAMVTHIGSSIISDAKAFVDCVGIPLELDTDGIWCLLPEGFPEDFFIKFKDGK
KARMDYPCSILNYLVYEKYCNRQYQTLVDPANLKYQTNLEMSIFFELDGPYRAMIIPAAR
EEGKLLKKRYVVFNKSGKLTELKGFEIKRRGELNIIKIFQSEIFSQFLAGKDLKECYEAC
AKVAKKWLNLLKNRGEGLNNEELIDYIGESKVLSKELAEYGEQKGVGITCAKRLKELLGP
DIVKGKSLCCNYVMSKKPQEASKAERAIPIQIFNSDPTIKKKFLRKWLKDNTLDDKQLEM
REILDWDYYIERLSNTIQKIIIIPAATQGVFNILPDVSVPDWLTKQIKEQEDKFQQQKLQ
FKNFKIPSQQPQSIMQALHNQQQMKLVGMSEDQQKPTQKSSTNKAFTHTTKVVQKPKKFV
NPYNMNTQFKDFLQAQKQHWIELKKYMQDFSYAQNISTLRQMFSNQDEFILKSDWHVLQI
APTDQLGVYKLWAFVIETKQIISVSVEIPRVIYVNSLVEYQADEQFKLVKKKLPREKRAY
YLYEISKKEEEFHSQFKDFEYFLSNPEIENIYEYHQPLDFKFIVQIGNVVKINQKSIPRG
TSYSNYVFKLEQFAGQFGDSKTYLEGMEISNSVIYIGELKMKDRKLWCILNAQISEYIFI
MVHKTVDKNKYSKIIRESLPENLVNPQMKIQTYNFDVNDKAFIFIENYLQEIKSKKVHGI
ILFQTSYTLQNLRAQGIKSIFTEYPCAQLPHLKMDESLYSSLDWQQKGMRFLCQQIENVQ
QNLENAYRLTEYVQVPICNLNFENSFSQLTDIYFGRLLRNDNCISWYGSYINNKEQEYRQ
LIPSDFLRNEISFSGLYTSHTVEIDIGLLALNTIAHADELKNIDKEASKLIDYSRVNNKQ
NKNKKGVQYQQQDHEEIDELTQAKQSFKNLQQMVQYWIHDVQQFENPIADFFITNIHSWL
TTKESKFYDPILSKMLQKLMKKIFQYFISKLRGLGAKIVHSTMNKIILDTGKNTLNEAKS
YTQYILQTVLGQPLFKVLTLTPQRYFKILLFKDSHNYMALQEFDSSNEEKETGQPNQTQH
SVISNWHISDFLPPKLKHYFQLVVLEYLYKITQQKAELATNPEYANTLVEEIESFCKKYI
SVNLSDKLLDAIPELETQYRRDRQQIEKLTQKQEEYIYLESQIIEQQKKLKKSQIENNYH
QDFDMDADYYDQIQQEKEEQQYKKKIQNQKENNNNTKQSQKAMVNEEDDQYENQLVDYEE
IENEQEDLDDFIVSQNEQEADNYYSEQEDGDDLNDSFVVDDVKDALYADIPATQDELSKL
KRIMKRDQKKLDELNNLWSFPQLLGGRVKYDNSILEFVNFLMHVFSLDQNVKDELIQVKR
DCLKFLKMNDFSNEAQFKEPCVIIKAADIVCKSCLQVCELDIFRDDWICQECRTPYDLHY
LENKFIELIKNSLTFYQFQDIYCKKCKMIKEDLLSNLCKCSGSYFFQIDENILPIIGPDS
KKIRRAFTELAQTNNFNTLLQMIQQTWII


>TTHERM_00112520(gene)
ATGCAAAAAGGAGAAAAGTAAAGGATTTAGGAAATAGTTGATTAGAAATTCGGCATTGAA
ACAGTCAAGGATGGGCCTGATCGGTTAGGTTTTATAGCAAATTTTAAGACTGCCTCCATT
GTAGATGAAGATATGAATGAGAGATCAGTTTTATAGATTTACTATGTAGAAGACAATGGC
AATTGGTGCAAGAGTACAATACTCTATTAGCCTTATTTTTATGTAGCTTGTGAGCGTAAT
TTAGAAAAAGAAATAGCATTCTTCTTGGAAAAGAAGTTTGAGAACAAAATTTCAAAAGTG
GAAATAGTAGAAAAAATAGATTTAGAGTAAATAAACCATTTGTCTGGAAAGAAAAAGAAG
TACATCAAAATATCTTTTAAAACTATTCAAGATTTATTAGGTGTAAGAGGGTAGCTTAAG
CCTAAGATTGATAAGAAAAAATAATAAGATTAGAATTCTTTATCTATTTATAGCAATAAT
TTTAATGGGCATATGAGTAGCACAATAACAGATTTCAATAAATTGGATTTGTTAGAATAT
ATTTCAGATATTAGAGAATATGATGTACCCTATCATTCTCGTGTCTGTATTGATTTGAAT
ATAAGAGCTGGTAAATGGTAATATCAAATTTTTATACTATCACAATTAATCTAAATTTTA
AAATCATTTCAAGTAAGATATTTCATATAAATAAATTTCTTTTTAAAATACAACAAACAG
GTTTAAAATATCCTTCAAAGACAATTTAGTAGATAAAATTGTTTGTATGGAAGATATAGT
GGAAAGACCAGATTTAAAATATTTAGCGTTTGATATTGAAACAAGTAAAGCAGAATTAAG
ATTTCCTGATGCCAAAACAGATTGTGTAATGATGATTTCCTTAATGTACGAAGGTGATGC
TTACTTAATTGTAAATAGAGATTTTTGTGGTTAGGATGTTGTAGGATTTGATTATGCTCC
TACTCCTGAGTTTGAGTGTTCTATTACAGTTTATAATGAACCAAATGAAAAAGCTTGCAT
CAAAAAATTCTTTGATATTATAGTAGACTACAAAGCATTTATCATTACAAGTTTTAACGG
TGACAAATTCGATTGGCCTTTTATTCATGAAAGATGTAACTAACTTGGTCTCTCATTAGA
AAAGGAAATAGGTATCCATTTAGAAGAAGGTCCAGAATATTTTGGAAGATATCTCACACA
TCTTGATTGTTTGTATTGGGTTATAAGAGATGCTTATTTACCTTAAGGAAGGTAAGCTTT
ATAAAAGATTATTTTATTTGTTTTATAAAAATTATTCTGAAATAAAATCATTTCCAAATT
TTTTAATTTATTTTTAAATATCAATCAATTAGTCACGGTTTGAAGGCTGTAACAAGATCT
AAGCTCGGTTATGAGCCTATTGAAGTAGATCCTGAGGAAATGGTTCCTCTAGCAAGAAAT
AATACTCAGGAATTAGCTGAATATTCAGTTTCTGATGCTGTTGCTACTTATTTTATATAT
AAAAAGCATATTCATGATTTTATTTTTGCTTTGTGCACAATTATTCCTTGTTATTCAGAT
GAAGTTTTGAGAAAGGGTTCAGGTACCTTGTGTGAAAATTTGTTAATGACAGAAGCATTT
AACAGAAATATAATTTTTCCAAATAAAAAAATGGAAGAAAAAGAAAAAATGCATAAAGGA
CATTGGTTAGATTCTGAGACATATATTGGTATTTATATTATTGAGTGACAAATATTAAAA
ATTTTTAATAAAAAAAAAACTTAGGTGGTAAAGTAGAATGCTTAAAGAGTGGTGTATTCA
GATCAGACATTAAATCAAAGTTTAAGTTTGAAAAAAATGCTTTCCAGACACTGATTGATA
ACATTGATAAATTATTAGACTTCGTTGTTAGAATTGAACAAAATAAAGAAGTAAAAGATG
TTGATGGATATGAATAGCTAAGAGCTTCAGTTGTTCAAAAATTAGAGTTTTTAAGAGATG
TGCCAAATCCTAATTGCCATGATGCCTTCCCACTTATTTATCACTTGGATGTCGCTGCTA
TGTATCCTAATATTATTTTAACAAATAGACTCTAGCCTGTAGCAATTGTAAATGAATAAA
TATGCTCAGGATGCTTATTTAATAGTGCATAAAATGAATGCAAGAGACCTTTAGATTGGT
AATGGAGGGGAGAGTATTTTCCTCTCAATAGAAATGAATTTGAAAAATTGAAGAGCGATC
TAGAATATGAAAGAGCTGCAAATGTAATAAATAATTTTAATTTTAAAATATTGTGTTACA
AGCCTTTCTTTTTTTGATAAATTTAGGATTAGCATTAAAATAACACAGAAGAATTTTATA
AAGCCTTAAAACAAAGAGTCAAAACTTACAGCTAAAAGACATATAAGACAATTCATGTAA
AAGAAACTTTAACAAAACAGAATACTGTTTGTATGCGTGAAAATTCCTTCTATATTGACA
CCGTTAAAGCTTTCCGTATGCATTTATTTAAAGCTAATACTTTTATTTCTATTGATTTTT
TAGTAATAAATAAATGAAATTTGAATTCTATTTTGAAGATGATTTAATTTCAATAGAATT
TATGATTGTTTAAATATTTTTAATTTAATAAAAATTAATTTAGGTGATCGTAGATATACA
TTCAAGCATTTGGTTAAGGTTTGGAAAGGCAAAGCTGATGAGGCTTCTAAAAAAGGTGAT
GCAGTTGGAAAGAAAGAAGCAAATTTAATGGAGGCTTTATATGAGTCTATGTAACTAGCT
CACAAAATTATTTTGAATAGTTTTTACGGTTATGTCATGCGTAAAGGCGCTAGATGGTAT
TCGATGGAAATGGCTGCTATGGTCACTCATATTGGTTCTAGTATTATATCAGATGCTAAA
GCATTTGTAGATTGTGTTGGAATTCCTCTTGAACTAGATACAGATGGTATTTGGTGTTTG
CTACCAGAAGGTTTCCCTGAAGATTTCTTTATTAAGTTTAAGGATGGTAAAAAAGCTAGA
ATGGACTACCCTTGCTCTATTTTGAATTACTTGGTTTATGAAAAATACTGTAACCGTTAA
TATTAGACCTTAGTTGACCCTGCAAATCTAAAATATTAGACAAACCTAGAAATGTCTATC
TTTTTTGAACTTGATGGTCCTTATAGAGCTATGATTATTCCAGCTGCTAGGGAAGAAGGT
ATTACAAATGAATTATAAATATTAAATTAATTGTTTTTTAAATTACAAGGTAAGCTGCTT
AAAAAGCGTTATGTTGTCTTCAACAAGAGTGGAAAACTAACAGAATTAAAAGGGTTTGAA
ATTAAGCGTAGAGGTGAGTTAAATATTATCAAAATATTCTAATCAGAAATTTTCAGCTAG
TTTTTAGCTGGTAAAGATTTAAAGGAATGTTATGAAGCTTGTGCTAAAGTTGCTAAAAAA
TGGCTTAATCTTCTCAAAAATAGGGTAATTTTTTGAATTTTAATTTCTAAAATTAAAAAA
AAATTTTAATCTCAGGGAGAAGGCTTGAATAACGAAGAGCTGATTGACTATATTGGTGAA
AGTAAAGTTCTTTCTAAGGAGTTAGCTGAGTACGGAGAATAAAAGGGTGTTGGTATTACA
TGTGCTAAGAGATTAAAAGAATTATTGGGGCCAGATATTGTTAAGGGTAAAAGTTTGTGC
TGTAATTATGTTATGAGTAAGAAACCATAAGAAGCAAGCAAAGCTGAAAGAGCCATACCC
ATATAAATATTCAATTCAGATCCTACAATAAAAAAGAAATTCTTACGTAAATGGTTAAAA
GATAATACCCTTGATGATAAGTAACTAGAAATGAGAGAAATACTTGATTGGGATTATTAT
ATTGAAAGATTAAGTAACACAATCTAAAAAATCATCATTATTCCAGCTGCCACATAAGGT
GTTTTTAATATTTTACCTGATGTCTCTGTTCCCGATTGGCTCACTAAATAAATTAAAGAG
CAAGAAGATAAATTTTAATAGCAGAAACTACAATTTAAGAATTTTAAAATTCCTTCTTAA
TAACCTTAAAGTATAATGCAAGCTCTTCACAACTAATAATAAATGAAACTTGTAGGCATG
TCTGAAGATTAATAAAAGCCAACATAAAAATCTTCTACAAATAAGGCATTCACTCATACC
ACAAAAGTAGTTTAAAAACCAAAAAAATTTGTGAATCCATACAATATGAATACTCAATTC
AAAGACTTCTTATAAGCCTAGAAACAACACTGGATAGAGTTAAAAAAATACATGCAAGAT
TTTAGTTATGCTTAGAATATTTCTACATTGAGGTAAATGTTTTCTAATCAAGATGAATTC
ATTCTCAAATCTGACTGGCATGTTCTTTAAATAGCACCCACAGATTAGTTAGGTATTTAA
AAAAACTATAATTACTCTATTTAATTAATATTTCTTTTATTTATTTTAGGTGTTTATAAA
TTATGGGCTTTCGTGATTGAAACAAAGTAAATTATATCTGTTTCAGTAGAAATTCCTAGA
GTCATTTATGTGAATAGTTTGGTTGAATACTAAGCTGATGAACAATTTAAGTTAGTGAAA
AAGAAACTTCCAAGAGAAAAAAGAGCTTATTATCTTTACGAAATTAGTAAGAAAGAAGAA
GAATTTCACTCTCAATTTAAAGACTTTGAGTACTTCCTTTCAAACCCTGAAATCGAAAAT
ATTTATGAATACCATTAGCCTTTAGATTTTAAATTTATTGTCTAAATAGGAAATGTTGTT
AAAATAAATTAAAAATCTATACCAAGAGGGACATCTTATTCAAATTATGTTTTTAAATTA
GAATAATTTGCAGGTAAAAATATTATTTATTGATAGATTAATAAATATAAAAATTCTTAA
TTTTCTTTTTAAAGGTTAATTTGGTGACTCTAAAACTTATTTAGAAGGTATGGAAATTTC
TAATTCTGTTATATATATTGGCGAGTTAAAGATGAAGGACAGAAAACTTTGGTGTATACT
GAATGCTTAAATATCTGAATACATTTTTATTATGGTACATAAGACTGTTGATAAAAATAA
ATATTCTAAAATAATCAGAGAGTCGTTGCCTGAGAATTTAGTTAATCCCTAAATGAAGAT
ATAAACATATAATTTTGATGTGAATGATAAAGCATTTATTTTTATAGAAAATTACCTTCA
AGAAATTAAATCTAAGAAAGTAAATATTATTTATTAAATAATTAGCTATGAAATTTATTT
AAAAAAATCATTTAAAAAACAGGTCCATGGTATCATTTTATTCTAGACTTCTTATACTTT
GCAGAATTTAAGAGCTTAAGGCATAAAATCTATATTTACTGAATATCCTTGTGCATAGCT
TCCTCATTTAAAAATGGATGAATCACTTTATAGTTCTTTAGATTGGCAACAAAAAGGTAT
GAGATTCTTATGTCAGTAAATTGAAAATGTTTAATAGAATCTTGAAAATGCTTACAGATT
AACTGAGTACGTTTAAGTACCCATATGCAATTTAAACTTTGAAAATTCATTTAGCCAATT
AACTGATATTTACTTTGGTCGTTTGCTTAGGTAATTAATTAATTTAACAACTTTATCTTT
TAATAAATATTCTCAAAGTTAATCAATAATAATAAATTATATTTTAGAAATGATAATTGT
ATTTCTTGGTATGGTAGCTACATAAATAATAAAGAATAGGAATACAGACAGCTTATTCCT
TCAGATTTCTTGAGAAACGAAATATCTTTTAGCGGTTTGTATACTTCACATACCGTCGAA
ATTGATATTGGTTTGCTCGCTCTCAACACTATTGCTCATGCTGATGAATTAAAGAATATT
GATAAAGAAGCTAGTAAGCTCATAGATTATTCAAGGGTAAATAATAAGTAAAACAAAAAC
AAAAAAGGAGTTTAGTATTAACAATAAGATCATGAAGAAATAGATGAGTTAACTCAAGCA
AAGCAATCCTTTAAGAATCTTTAGTAAATGGTATAATACTGGATACATGATGTATAGCAA
TTTGAGAATCCTATTGCAGATTTTTTCATTACCAATATTCACTCATGGCTAACAACAAAA
GAGTCTAAATTTTATGATCCTATTCTCTCAAAAATGCTTCAAAAACTCATGAAGAAAATT
TTCTAATATTTTATTTCTAAACTAAGAGGTCTAGGTGCTAAAATTGTTCATTCTACAATG
AATAAGATTATTCTTGATACTGGCAAAAATACTTTAAATGAAGCTAAAAGCTATACTCAA
TATATCCTCCAAACTGTGCTTGGCTAGCCTCTCTTTAAGGTGCTGACTTTAACACCATAA
AGATATTTCAAGATTTTACTTTTTAAAGATTCCCATAATTACATGGCTCTGTAAGAGTTT
GACAGTAGTAATGAAGAAAAAGAAACAGGCTAACCTAATTAAACATAGCATTCTGTTATT
TCTAATTGGCATATTTCAGATTTTTTACCACCAAAATTAAAACACTATTTCCAACTTGTT
GTTTTAGAATATTTGTATAAAATAACTCAATAAAAAGCTGAATTAGCAACAAATCCTGAA
TATGCTAATACACTAGTTGAGGAAATCGAATCATTCTGCAAAAAGTATATTTCGGTTAAT
CTATCAGATAAACTATTAGACGCTATTCCAGAATTGGAAACATAATATAGAAGAGATAGA
TAGCAAATAGAAAAACTAACTTAAAAATAAGAAGAATACATATACCTTGAAAGCTAAATT
ATTGGTAATTAATTTTTCTCATTTTTTTAATAAAACTATTTAGGAAATTATTTTTATTTT
TCGTATTTTGAAATTGTTTTAATAAATTAATTTTATTAATATTAGAATAACAAAAGAAAT
TGAAAAAATCTTAAATAGAAAATAATTACCATTAAGATTTTGATATGGACGCAGATTACT
ATGATTAAATTTAGCAAGAAAAAGAAGAATAGCAATACAAAAAAAAGATTCAGAACTAAA
AAGAAAATAATAATAATACTAAGCAATCTTAAAAAGCAATGGTAAACGAAGAGGATGATT
AATATGAAAACTAACTTGTAGATTATGAAGAAATAGAAAATGAGTAAGAAGATTTAGATG
ATTTTATAGTTTCTTAAAATGAGCAAGAAGCTGATAATTATTATTCTGAGTAAGAAGATG
GTGATGATTTAAATGATTCTTTCGTTGTTGATGATGTAAAGGATGCTCTTTATGCAGACA
TCCCAGCAACATAGGATGAACTTTCTAAGCTTAAAAGGATAATGAAGAGAGATTAAAAAA
AATTAGATGAGCTAAATAATTTATGGAGTTTTCCATAGCTTCTTGGTGGTAGAGTTAAAT
ATGATAACTCTATATTAGAATTTGTAAACTTTTTGATGCATGTGTTTAGCCTGGATTAGA
ATGTTAAAGATGAATTAATTTAGGTTAAGAGAGATTGCTTGAAATTCCTTAAAATGAATG
ATTTTTCAAATGAAGCTTAATTTAAAGAGCCCTGTGTTATCATAAAAGCAGCTGATATAG
TATGCAAGAGTTGTCTCTAAGTATGTGAGCTAGACATATTCAGAGATGATTGGATCTGTC
AAGAATGCAGAACCCCTTATGATTTACATTATCTTGAAAATAAATTTATAGAACTAATTA
AAAACTCATTAACTTTCTATTAGTTCCAAGATATATATTGTAAGAAATGTAAAATGATAA
AAGAAGACCTTTTGAGTAATCTTTGCAAATGCTCAGGTTCATACTTCTTCTAAATTGATG
AAAATATTTTACCAATAATTGGTCCTGATTCTAAAAAAATAAGAAGAGCCTTTACAGAGC
TTGCCCAAACTAACAATTTCAATACTCTCTTACAAATGATTTAATAGACATGGATTATTT
GA