Identifiers and Description

Gene Model Identifier

TTHERM_00614820

Standard Name

POL12 (DNA polymerase alpha subunit B)

Aliases

PreTt19130 | 85.m00123 | 3725.m00016

Description

Homolog of Saccharomyces POL12, B subunit of DNA polymerase alpha-primase complex.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF04042 ) DNA polymerase epsilon subunit B

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00614820

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18325.19.997093137033517e-262hypothetical protein (597 aa)
OxytrichaContig11781.0.0.g160.00000000000004998767099442072DNA polymerase alpha/epsilon s
ubunit B
SGDYBL035C0.00000000000006002591555650462POL12 B subunit of DNA polymer
ase alpha-primase complex, req
uired for initiation of DNA re
plication during mitotic and p
remeiotic DNA synthesis; also
functions in telomere capping
and length regulation
DictyBaseDDB_G02827310.00000000000040012475857291343polA2 on chromosome: 3 positio
n 6220731 to 6222999
WormBaseWBGene000010020.0000000000008001317446409227locus:div-1 DNA polymerase a
lpha subunit B status:Partia
lly_confirmed UniProt:Q21625
protein_id:CAA83467.2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00614820(coding)
ATGGAAGAATTTGAAAAAATATTAGAAGAAATTGATTCTGCTAATTTAAGCCAAAATGCA
GTTTAATAATTGAAATAGTTAATTATTAGCAATGGAATATTAGATGATGAGTAATTAATG
GAAAAGTGGCTCTTTTAATTGGAGGCAATCATTTACAATAGCAAGTAAAAGTTTCTTGAA
GCTTAACTGATGGATTTTAAGAAGAATGTGCTTAATTAGGACATCAAAAAACCTCAAAAT
GACAATTTTAAAAAAATAAAGGAATCTGAAGTTTAAAAAAATATAGACATTATTAAAGGT
GATGCAGATTTATTTACTAAAGCTTCTTCAGCCAAAAAACAGACATCTACTTAATAAGCA
AATAATGCAGCAATTGATTGCGAAGAATAATTGCGTTAGTAGTTAGGAAAGGAATCAATG
CTAGACCCAAAACGTTTTTCATATAATAGTAACCTTCCCTAGGTAAACTTCGAAAAAAAT
TAGCATTAGAATTCCAACAATATGACTATTGTCGATTTATTTGAATAATACGATCCTAAT
AAAATTCCTAACTACTTAACAAATAATATTGATAAAATTCGCAAACATCTCGAATAAAGG
ATCCTAACTTTCAAAATACAAAATTACAGTTAATTTATAGTTAACGGTGAATAGTTAATA
AATGATGTCAGCTCTTACTCTAAGACAGAAGAAGTAAAAATGGTTGGCAGATTGATATCG
ACAGAAAATGGTTTTTTGAATACAACAAATTTAAGGATAGAACTTAATAGAAATCAATAT
TTCGATCTCGTCTTTGAAAACGATTTTGATTTTGGTAACAATGTTCTTTTTCCTAATTAG
ATAGTGATGGTTAAAGGTATCATAAATGAAAAAGAAGAATTAGTAGTAAGTGAGTTAATC
ACAGATCACATTAAGGAAATAACTGATGAAGAACATCCAAAAATTGATAATTTGAACTAA
GATGAAAGTTAGCTTATCATGGTAGCTGCAGGTCCTTTTTCTACTGTTATGTCTACTTAA
TATACATCATTTGATAACATTCTTCATGTTGCAAAGACTAAGAAAGTAAGCACTCTTATC
CTTCTTGGACCATTTTTAGATATAAAGAATGAAATTTTAAAAGATGGCAGTATTATAATA
AATAGCAAAGAATATACTTTTGAGTAATTGTAAAATTCCTTGTTTGAAAAAGCTGTAAAG
GAATTAGAAGGAAAAACTTAAATAATCATTGTCCCTTCTACTCGCGATATTCTTTCCACT
GACTCTATTCCTTAAATGAGTCTTGAAATTAAAGTTTCTGAACATAAGAATTCTATTCAC
TCTTACTCTAATCCAGCTTATATTGATATTGATAAATTAAGAGTTTACATTGCTAACTCA
GATGTCGGTATGATCACTCTTTAAAATAGTTTGTTAGATAAAAAGATTCCCTACATGCAG
CAATCACGTCTTACTTTTAAAGCACTTATGAATTAATAAAATTTGTACTCCATATATCCT
ATGAGAAATCCACAAGATTCATAATAAATATTAGAAACTGTAAAACTTCCTAATATAAAT
GATTTTGACATCCCTTTTGACTACTAGCTAGAATAATATCCTCATATAATTATCTCTCCT
TCATCTCTACCAAAATTTGCAACTAAAATCTATAATACCGTCGTCATAAATCCTAATTAT
GTTATACGTGATGGCTCATAAGCAGGAAATTTTGCTATAATTACTTTATTCAAAGATTCT
GACATTCCTATTCACGAAAGAACTCGTGTAGATTTATATTGTTTGTGA


>TTHERM_00614820(protein)
MEEFEKILEEIDSANLSQNAVQQLKQLIISNGILDDEQLMEKWLFQLEAIIYNSKQKFLE
AQLMDFKKNVLNQDIKKPQNDNFKKIKESEVQKNIDIIKGDADLFTKASSAKKQTSTQQA
NNAAIDCEEQLRQQLGKESMLDPKRFSYNSNLPQVNFEKNQHQNSNNMTIVDLFEQYDPN
KIPNYLTNNIDKIRKHLEQRILTFKIQNYSQFIVNGEQLINDVSSYSKTEEVKMVGRLIS
TENGFLNTTNLRIELNRNQYFDLVFENDFDFGNNVLFPNQIVMVKGIINEKEELVVSELI
TDHIKEITDEEHPKIDNLNQDESQLIMVAAGPFSTVMSTQYTSFDNILHVAKTKKVSTLI
LLGPFLDIKNEILKDGSIIINSKEYTFEQLQNSLFEKAVKELEGKTQIIIVPSTRDILST
DSIPQMSLEIKVSEHKNSIHSYSNPAYIDIDKLRVYIANSDVGMITLQNSLLDKKIPYMQ
QSRLTFKALMNQQNLYSIYPMRNPQDSQQILETVKLPNINDFDIPFDYQLEQYPHIIISP
SSLPKFATKIYNTVVINPNYVIRDGSQAGNFAIITLFKDSDIPIHERTRVDLYCL


>TTHERM_00614820(gene)
ATGGAAGAATTTGAAAAAATATTAGAAGAAATTGATTCTGCTAATTTAAGCCAAAATGCA
GTTTAATAATTGAAATAGTTAATTATTAGCAATGGAATATTAGATGATGAGTAATTAATG
GAAAAGTGGCTCTTTTAATTGGAGGCAATCATTTACAATAGCAAGTAAAAGTTTCTTGAA
GCTTAACTGATGGATTTTAAGAAGAATGTGCTTAATTAGGACATCAAAAAACCTCAAAAT
GACAATTTTAAAAAAATAAAGGAATCTGAAGTTTAAAAAAATATAGACATTATTAAAGGT
GATGCAGATTTATTTACTAAAGCTTCTTCAGCCAAAAAACAGACATCTACTTAATAAGCA
AATAATGCAGCAATTGATTGCGAAGAATAATTGCGTTAGTAGTTAGGAAAGGAATCAATG
CTAGACCCAAAACGTTTTTCATATAATAGTAACCTTCCCTAGGTAAACTTCGAAAAAAAT
TAGCATTAGAATTCCAACAATATGACTATTGTCGATTTATTTGAATAATACGATCCTAAT
AAAATTCCTAACTACTTAACAAATAATATTGATAAAATTCGCAAACATCTCGAATAAAGG
ATCCTAACTTTCAAAATACAAAATTACAGTTAATTTATAGTTAACGGTGAATAGTTAATA
AATGATGTCAGCTCTTACTCTAAGACAGAAGAAGTAAAAATGGTTGGCAGATTGATATCG
ACAGAAAATGGTTTTTTGAATACAACAAATTTAAGGATAGAACTTAATAGAAATCAATAT
TTCGATCTCGTCTTTGAAAACGATTTTGATTTTGGTAACAATGTTCTTTTTCCTAATTAG
ATAGTGATGGTTAAAGGTATCATAAATGAAAAAGAAGAATTAGTAGTAAGTGAGTTAATC
ACAGATCACATTAAGGAAATAACTGATGAAGAACATCCAAAAATTGATAATTTGAACTAA
GATGAAAGTTAGCTTATCATGGTAGCTGCAGGTCCTTTTTCTACTGTTATGTCTACTTAA
TATACATCATTTGATAACATTCTTCATGTTGCAAAGACTAAGAAAGTAAGCACTCTTATC
CTTCTTGGACCATTTTTAGATATAAAGAATGAAATTTTAAAAGATGGCAGTATTATAATA
AATAGCAAAGAATATACTTTTGAGTAATTGTAAAATTCCTTGTTTGAAAAAGCTGTAAAG
GAATTAGAAGGAAAAACTTAAATAATCATTGTCCCTTCTACTCGCGATATTCTTTCCACT
GACTCTATTCCTTAAATGAGTCTTGAAATTAAAGTTTCTGAACATAAGAATTCTATTCAC
TCTTACTCTAATCCAGCTTATATTGATATTGATAAATTAAGAGTTTACATTGCTAACTCA
GATGTCGGTATGATCACTCTTTAAAATAGTTTGTTAGATAAAAAGATTCCCTACATGCAG
CAATCACGTCTTACTTTTAAAGCACTTATGAATTAATAAAATTTGTACTCCATATATCCT
ATGAGAAATCCACAAGATTCATAATAAATATTAGAAACTGTAAAACTTCCTAATATAAAT
GATTTTGACATCCCTTTTGACTACTAGCTAGAATAATATCCTCATATAATTATCTCTCCT
TCATCTCTACCAAAATTTGCAACTAAAATCTATAATACCGTCGTCATAAATCCTAATTAT
GTTATACGTGATGGCTCATAAGCAGGAAATTTTGCTATAATTACTTTATTCAAAGATTCT
GACATTCCTATTCACGAAAGAACTCGTGTAGATTTATATTGTTTGTGA