Identifiers and Description

Gene Model Identifier

TTHERM_00424700

Standard Name

POL1 (DNA polymerase alpha-primase complex catalytic subunit POL1)

Aliases

PreTt14004 | 47.m00199

Description

DNA polymerase catalytic subunit

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00136 ) DNA polymerase family B
  • ( TIGR00592 ) DNA polymerase (pol2)
  • ( TIGR01396 ) flagellar basal-body rod protein FlgB
  • ( PF03104 ) DNA polymerase family B, exonuclease

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00424700

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00216.19.997093137033517e-262DNA polymerase catalytic subun
it (3569 aa)
OxytrichaContig22794.0.g894.998437866964194e-166DNA polymerase family B
WormBaseWBGene000129365.0014192254601655e-126DNA polymerase status:Partia
lly_confirmed UniProt:Q9NAH1
protein_id:CAB97239.2
SGDYNL102W9.997962730346853e-122POL1 Catalytic subunit of the
DNA polymerase I alpha-primase
complex, required for the ini
tiation of DNA replication dur
ing mitotic DNA synthesis and
premeiotic DNA synthesis
DictyBaseDDB_G02821918.002072745601587e-114polA1 on chromosome: 3 positio
n 5500018 to 5504728
Stentor CoeruleusSteCoe_304284.248354255291589e-18

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00424700(coding)
ATGAGTGACAAATTAACAAGATTAGAGAGACTCAATAAAGAAGTCAAAAAGCAAAACAAG
CTCAAATAGCACTCAAAGAACAATCGCTTTGATGATGACATGGATATTGAGGCATATGAG
GATGATGAATAGATAGAAGAAGATGATTTTATAGATGACACATAAGAGGATAAAAAATAT
AAAAAGAAATATAGAGAAATAGAAGATGAGTTCGACCAAGAGATTGAAGAGGAAGAGGAG
TTAAATAAAAAGAAGAAGACTAAGAATACAATTTTAAATTATACAAACACCACAGCTGTT
ACCAATAATAAGAAAAAGGCAATTAGCAAGTAGATTCCAGATATTGATATTGAAGAAATT
ATGAAGCTAACTGAGAGGAAAAAAAAAATAGAGTAAGAAGAAGCTCAGCTACTTTAGGAA
GAACAAGAACTCTTAGAATAAGAAAAAAGGGAGGAAGAGGAAAAGAAGCGTATTAGTTAA
GAAGCAAAAAGTATTTTAAGAGAAGATTGTGCCTCTTCAAAGACAGCAAATAGCAGCAAA
GGGAAAGTAGATTAGAATATTTTAAATGCAATCAACAGAGACTTTTCTGATGACAGTAAT
ACAGTAGACAGCATTTCTGAATTTTAGAAATTAAAAAGTTTAGCACAAAAAGCTAATTTG
GCAAACGAGAGCCTAAAATAAAGCAAAGTCAGCAATACAGAAATTAATTTGACTAACCTC
TCTATTTCTTAAGTGAAAAAGATCAATGACTATAAGAATGAAGATGGTTCTGTTGATGCT
TATTTGTATGATTACTTTTATGATGCCTAAGTTAAACCTGATAAAATATATGCATTTGCC
AAAGTTTAAAACAAGCAAACAAATGCTTTTGATACTTGTGTTATTCAAATTGATACTATT
ATCAGAAATCTCTTCTTCTATCCTTCTTCTGACACAGTTACTGAGCAGCAAATTAAAAAT
GAAATTGCAGAACTTTTAAAGAAGGAGCAAACATCACGTAAAAATGTAGAATTTTTAGGT
GCTTTTGTTGATAAGAACTACGCTTTTGAATTGCCTATACCAAGAGGTAAAAGTAGATGG
TATTAAGTTGTAATGTCTTATGAATATGAAGTGATTAGTCCAGATACAAAGGGATAATAT
TTTTCTTATTGTGTTGGTTCTACTTACAGTGCTTTAGAGACATTCCTCATTACAAAGAAA
ATTACTGGACCAAGTTGGGTACGCTTTTAAAATGTGAAGGATACTACTTCATGCATAACA
AATAGAAAATTAGAATTTAGAGTAGATTATACTAATTAATCAAATATATAAGTATTACAA
AAATAATTGCCAACTCCTCCCTTGAGCGTTGTTTGTATCTCACTTAAAACTAGCTAGCAA
ATTGTACTCAGTTAAAAGAAAAAGGAATATAAAAAGGAAATCTTTAATCTAAACATGAAA
TACCACGAAGGTATAAATATTGATAATTCAAACAAAGATGAACTCAACTAGTTTAAGAGT
ATTTCCTTCATAACTCACATAGATCCCACTAAAAAGTAAGATAGTATCACTAAAAAGGGT
ACTCTTCCTGAAACAACTAAGTTTTGCTTAAATGAACTGAACCTATTAGAGTAGTTTTTA
GTTCATTTTAATGAGATTGATCCTGATATTGTTGTGGCACATGATCTATACTCTACTGTT
TTTGAAATTATTCTCACAAGAATCCGTGAAAAGGGAATCAGAAAATGGAATCTTCTTTCC
AAGCTTATAAATATTGGCTCGTCTGACATTCCAAAATATGGTTCTTCTACTTTTAAAACT
AAAATGGCAATGAAAGGTCGTCTTTTAGTAGACACTTTATTGAGTTCTCAAGAATTCGTT
AACTGTGTTGAGTACACTCTTGAAGCCTTGGCTTAAAAGCTCTTTAAAATAGAAATTCCC
AGAATAGATGCAAAGGCTTATTAATAGAAATTCGCTACTTATAAATTGCTTAACAGTTTG
GTAGATGACACATATTAGGATATTGATTATGCACTTAGGATCATGTACCATTTACAAATT
GTTCCTCTTACTAAGTAACTTACTTCAATTTGTGGTAACATTTGGATGGGTTCCCTATAA
AACTAAAGAGCAGAAAGAAACGAAATGCTTCTCCTTCATAAGTTTAATTAACTGAATTAC
GTTTATCCTGATAATTTTAAAAATCTACCAGAATCATATAAAAAGAAACACAAAAATGCT
TAGATTAGAAAGTAATATGAAGAAGATGAGGATTAAGCTCAAGGAAATAAAAATCCTAAA
AAGAAAGAAAATAAATACAAGGGTGGTTAAGTATTTGAACCTGAAAAAGGTTTGTATAAT
GAGTACATCGTACTGTTGGATTTCAACTCTCTTTATCCTTCAATTATATAGGAATTCAAT
GTTTGCTTTACTACTTGCGTGAGAGATCCTATACCTCTTGAAATGCAAATGGCTCCCTTC
TTGGGAAATAAAAAGGCTGCTATTTAATACTCTAAAAATTAAAATACTAAAGAGAATAAA
ATGTAAGATGAAGACGAGGAAGACAATGAAAATGAATAAATTGTTCAAACTCATGATGTT
CTTCCTACCATAGAAGTTATTAAAGGAATTGCTCCTCTTCCATCAATTTTATAATATTTG
GTAGAACAAAGAAAAGTTGTAAAGAATCAAATCAAAGGCTAAAAAGATCCATAAGTTATC
GAAACTTTAGATATTAAATAGAAAGCTTTCAAGCTTGTTGCTAATTCTATGTATGGTTGC
TTGGGTTTCAGCTCTTCTCGTTTCTATGCTATGCCACTTGCATCCTTCATTACAGCTAAA
GGTAGACATATTCTATTTGATTCAAAGAAAATTGTAGAAGACATGGGCTATTCTGTAATC
TATGGTGACACAGATTCTTTGATGATAAAACCTGGCACAAATGAGTTCCTTGAAGCAGTA
AAAACAGGCTTAAGCATAAAAATAAAAGTCAACAGCAAATATAAGAAACTTTAATTAGAC
ATTGATGGTGTGTTCAAAAATATGCTTTTACTCAAAAAGAAAAAATATGCTACTTTGAAG
GTTGCAAACTGGGAAGAGGTAAAAAATACAAATGCTCCTGAAAAGTTAGAAAAAGAAATT
AAAGGTATTGACGTTGTTCGTAGAGATTGGTGTTAATTATCCAGAGATGCTGGTAATAAA
ATCCTAGAAATTATATTAGAGAGCAAAAGCAGTGAAAATATGTTAGATGATATCAAGAAA
TATTTGATTTAGCTGAATGATGACATAAATTAAAAGAACATTAAAAACAGCAACTATTAT
ATCACTAAGCGTTTGACTAAAAGAGTAGATTAATATGGTGAAAAGAACCTTCCTCACGTA
GCTGTTGCTCAAAGATCCATTTAAGAAAAAGGTATTGACCCTTAAACATACGTCAATCAA
ATTATCAGTTATATCATCTGCAAAAATGAATAATCTAGCAGATTAGTAGATAAGGCTTAT
AGTCCTTAAGAATTTATCACTTAAAGTAAAAGTTTGGAAATAGACTTATAATACTATAAG
AGATTTTAACTTTTTGAACCAATAAAGAGAATGTTAGAAGTAATCGAGGGTATTAATCTT
TAAGAAATTGCAAGTATTCTTGAAGTTCACTACTCTGTCTAGCATGTTAGTTAAAATAAT
GAACTAAATGCTGAAAATGTACTTAACTTGAAGAGTAAAAGAAATCAATTTTTAACATCT
ATTCCTCGTGTATTGGTAGATTGTAAGAAGTGTGATCAAACTTTCTTGTTTTTAGGTATT
CTTGAAGAAAATGCAGATGCTGCTTCGATTCTAAAATGCAAGTGTGGAAACGATATTTAT
ATTTAACTTAAAAATAAAATAGCTCTTGTTGTTAAAGAGTTAATTAGAAATTTTGAAGAA
AATGCAATTCAAATTGATAATGAAGAATTTGAATATACTCACTAAATTTCTTTAGTAGGA
AAAGCCAAATAATAAAAAATGAGTAGCTTCACTTTGAACTAAAAGCTTCTTTCTATTCAA
GCTATGTTTGATATCACAAAAGAGGAATAAGAAAATACTCAAAAGGTCACTATAGAAAAA
ATAAAAACAATTAAAAAAACACTTGATGATTTATTGTCAAAATCTTAATACAATAATTTA
AATTTAAGCAATATTTTTACAAGTTTCGGGTTATTAAAATGA


>TTHERM_00424700(protein)
MSDKLTRLERLNKEVKKQNKLKQHSKNNRFDDDMDIEAYEDDEQIEEDDFIDDTQEDKKY
KKKYREIEDEFDQEIEEEEELNKKKKTKNTILNYTNTTAVTNNKKKAISKQIPDIDIEEI
MKLTERKKKIEQEEAQLLQEEQELLEQEKREEEEKKRISQEAKSILREDCASSKTANSSK
GKVDQNILNAINRDFSDDSNTVDSISEFQKLKSLAQKANLANESLKQSKVSNTEINLTNL
SISQVKKINDYKNEDGSVDAYLYDYFYDAQVKPDKIYAFAKVQNKQTNAFDTCVIQIDTI
IRNLFFYPSSDTVTEQQIKNEIAELLKKEQTSRKNVEFLGAFVDKNYAFELPIPRGKSRW
YQVVMSYEYEVISPDTKGQYFSYCVGSTYSALETFLITKKITGPSWVRFQNVKDTTSCIT
NRKLEFRVDYTNQSNIQVLQKQLPTPPLSVVCISLKTSQQIVLSQKKKEYKKEIFNLNMK
YHEGINIDNSNKDELNQFKSISFITHIDPTKKQDSITKKGTLPETTKFCLNELNLLEQFL
VHFNEIDPDIVVAHDLYSTVFEIILTRIREKGIRKWNLLSKLINIGSSDIPKYGSSTFKT
KMAMKGRLLVDTLLSSQEFVNCVEYTLEALAQKLFKIEIPRIDAKAYQQKFATYKLLNSL
VDDTYQDIDYALRIMYHLQIVPLTKQLTSICGNIWMGSLQNQRAERNEMLLLHKFNQLNY
VYPDNFKNLPESYKKKHKNAQIRKQYEEDEDQAQGNKNPKKKENKYKGGQVFEPEKGLYN
EYIVLLDFNSLYPSIIQEFNVCFTTCVRDPIPLEMQMAPFLGNKKAAIQYSKNQNTKENK
MQDEDEEDNENEQIVQTHDVLPTIEVIKGIAPLPSILQYLVEQRKVVKNQIKGQKDPQVI
ETLDIKQKAFKLVANSMYGCLGFSSSRFYAMPLASFITAKGRHILFDSKKIVEDMGYSVI
YGDTDSLMIKPGTNEFLEAVKTGLSIKIKVNSKYKKLQLDIDGVFKNMLLLKKKKYATLK
VANWEEVKNTNAPEKLEKEIKGIDVVRRDWCQLSRDAGNKILEIILESKSSENMLDDIKK
YLIQLNDDINQKNIKNSNYYITKRLTKRVDQYGEKNLPHVAVAQRSIQEKGIDPQTYVNQ
IISYIICKNEQSSRLVDKAYSPQEFITQSKSLEIDLQYYKRFQLFEPIKRMLEVIEGINL
QEIASILEVHYSVQHVSQNNELNAENVLNLKSKRNQFLTSIPRVLVDCKKCDQTFLFLGI
LEENADAASILKCKCGNDIYIQLKNKIALVVKELIRNFEENAIQIDNEEFEYTHQISLVG
KAKQQKMSSFTLNQKLLSIQAMFDITKEEQENTQKVTIEKIKTIKKTLDDLLSKSQYNNL
NLSNIFTSFGLLK


>TTHERM_00424700(gene)
ATGAGTGACAAATTAACAAGATTAGAGAGACTCAATAAAGAAGTCAAAAAGCAAAACAAG
CTCGTAATTAATCGAGTTCTTTTTTAGGATATCAATCAATTTTTTTATCAAATGTAATTA
GAAATAGCACTCAAAGAACAATCGCTTTGATGATGACATGGATATTGAGGCATATGAGGA
TGATGAATAGATAGAAGAAGATGATTTTATAGATGACACATAAGGTTAATTAATTAATTA
AACAAATGATATATCTTATCTATTTTTTATTATTAATAGAGGATAAAAAATGTAATAATT
TTAATGACAGAAATCTTAGATTTCAGAGAAAGCAAACAAGAGCAATTTATTTTACAATTT
AAATATTTAGATAAAAAGAAATATAGAGAAATAGAAGATGAGTTCGACCAAGAGATTGAA
GAGGAAGAGGAGTTAAATAAAAAGAAGAAGACTAAGAATACAATTTTAAATTATACAAAC
ACCACAGCTGTTACCAATAATAAGAAAAAGGCAATTAGCAAGTAGATTCCAGATATTGAT
ATTGAAGAAATTATGAAGCTAACTGAGAGGAAAAAAAAAATAGAGTAAGAAGAAGCTCAG
CTACTTTAGGAAGAACAAGAACTCTTAGGTAGAATTTTGTTAAATAGATTTTTTAGTAAT
TAACTTAACTAGAATAAGAAAAAAGGGAGGAAGAGGAAAAGAAGCGTATTAGTTAAGAAG
CAAAAAGTATTTTAAGAGAAGATTGTGCCTCTTCAAAGACAGCAAATAGCAGCAAAGGGA
AAGTAGATTAGAATATTTTAAATGCAATCAACAGAGACTTTTCTGATGACAGTAATACAG
TAGACAGCATTTCTGAATTTTAGAAATTAAAAAGTTTAGCACAAAAAGCTAATTTGGCAA
ACGAGAGCCTAAAATAAAGCAAAGTCAGCAATACAGAAATTAATTTGACTAACCTCTCTA
TTTCTTAAGTGAAAAAGATCAATGACTATAAGAATGAAGATGGTAAATTTGGAATTAATT
TTGTTTTATAATAGATTTATATGTTGTAAATTAATTTTAAAAATAAATAGGTTCTGTTGA
TGCTTATTTGTATGATTACTTTTATGATGCCTAAGTTAAACCTGATAAAATATATGCATT
TGCCAAAGTTTAAAACAAGCAAACAAATGCTTTTGATACTTGTGTTATTCAAATTGATAC
TATTATCAGAAATCTCTTCTTCTATCCTTCTTCTGACACAGTTACTGAGCAGGTATCAAT
TAAAAATTCATTCATTATTTTAAACCTATAAACTAAACAAATAATTAGAAATGATTTTTA
ATCTTTCCTTATTTATTTATTAATGTAGTCTAATTTCTTTATTGTGATAGAAATTTTTTA
ATTTTAAAAGTATTCCTTAGAATTAAATTGTAAAAATAAATAAAAGGGATAAATAAAATA
ATAAAATTTAAAGTCATATGAAAAATTTAATAAAGGTTCAATATAAATGTTGGTCAAATA
GCAATTAATTTAGCAAATAAATAGAGTCTATTTCATAGATAATAATTATTCAATTAAATA
CAATGAAATTTCTTTTTGAAAATTAAATCTTTTAGAAAATGAATGAAAAACTTGAACTTT
CTCTTTGAAAAATTTAATAAATTTTTTTATAATTAAGCAAATTAAAAATGAAATTGCAGA
ACTTTTAAAGAAGGAGCAAACATCACGTAAAAATGTAGAATTTTTAGGTGCTTTTGTTGA
TAAGAACTACGCTTTTGAATTGCCTATACCAAGAGGTAAAAGTAGATGGTATTAAGTTGT
AATGTCTTATGAATATGAAGTGATTAGTCCAGATACAAAGGGATAATATTTTTCTTATTG
TGTTGGTTCTACTTACAGTGCTTTAGAGACATTCCTCATTACAAAGAAAATTACTGGACC
AAGTTGGGTACGCTTTTAAAATGTGAAGGATACTACTTCATGCATAACAAATAGAAAATT
AGAATTTAGAGTAGATTATACTAATTAATCAAATATATAAGTATTACAAAAATAATTGCC
AACTCCTCCCTTGAGCGTTGTTTGTATCTCACTTAAAACTAGCTAGCAAATTGTACTCAG
TTAAAAGAAAAAGGAATATAAAAAGGAAATCTTTAATCTAAACATGAAATACCACGAAGG
TATAAATATTGATAATTCAAACAAAGATGAACTCAACTAGTTTAAGAGTATTTCCTTCAT
AACTCACATAGATCCCACTAAAAAGTAAGATAGTATCACTAAAAAGGGTACTCTTCCTGA
AACAACTAAGTTTTGCTTAAATGAACTGAACCTATTAGAGTAGTTTTTAGTTCATTTTAA
TGAGATTGATCCTGATATTGTTGTGGCACATGATCTATACTCTACTGTTTTTGAAATTAT
TCTCACAAGAATCCGTGAAAAGGGAATCAGAAAATGGAATCTTCTTTCCAAGCTTATAAA
TATTGGCTCGTCTGACATTCCAAAATATGGTTCTTCTACTTTTAAAACTAAAATGGCAAT
GAAAGGTCGTCTTTTAGTAGACACTTTATTGAGTTCTCAAGAATTCGTTAACTGTGTTGA
GTACACTCTTGAAGCCTTGGCTTAAAAGCTCTTTAAAATAGAAATGTAAAAATACAATTA
AATTTATAAAAAACTATTTACTTTTTAAAATGATTCAAAGAGTAAACTTCAAACAAAATA
AAATTTGAATACAATTTAATCGAAAGCTTAATTAAAATTATTAATGAAATTCTCAAAATC
ATTAAAAAAATTTAATAATAAAATCTAAAAAATAATTTTAAAATTATAATGGAAATATTA
ATAAATATTTGAAATAATGTTAAATAAATGAGTCATGCTTTGATTAATTAAAAAGCATGG
TCTAGGATATAATTTAAATTAAAGATTGAAATCAAGTTAAAATAAAAATTTTTTATATTC
AAATTAGTCCCAGAATAGATGCAAAGGCTTATTAATAGAAATTCGCTACTTATAAATTGC
TTAACAGTTTGGTAGATGACACATATTAGGATATTGATTATGCACTTAGGATCATGTACC
ATTTACAAATTGTTCCTCTTACTAAGTAACTTACTTCAATTTGTGGTAACATTTGGATGG
GTTCCCTATAAAACTAAAGAGCAGAAAGAAACGAAATGCTTCTCCTTCATAAGTTTAATT
AAGTAATTATTGAACTAACTAAAAATTACATTATTAATAATTTATTAAATATAATTAATT
AAAGCTGAATTACGTTTATCCTGATAATTTTAAAAATCTACCAGAATCATATAAAAAGAA
ACACAAAAATGCTTAGATTAGAAAGTAATATGAAGAAGATGAGGATTAAGCTCAAGGAAA
TAAAAATCCTAAAAAGAAAGAAAATAAATACAAGGGTGGTTAAGTATTTGAACCTGAAAA
AGGTTTGTATAATGAGTACATCGTACTGTTGGATTTCAACTCTCTTTATCCTTCAATTAT
ATAGGAATTCAATGTTTGCTTTACTACTTGCGTGAGAGATCCTATACCTCTTGAAATGCA
AATGGCTCCCTTCTTGGGAAATAAAAAGGCTGCTATTTAATACTCTAAAAATTAAAATAC
TAAAGAGAATAAAATGTAAGATGAAGACGAGGAAGACAATGAAAATGAATAAATTGTTCA
AACTCATGATGTTCTTCCTACCATAGAAGTTATTAAAGGAATTGCTCCTCTTCCATCAAT
TTTATAATATTTGGTAGAACAAAGAAAAGTTGTAAAGAATCAAATCAAAGGCTAAAAAGA
TCCATAAGTTATCGAAACTTTAGATATTAAATAGAAAGCTTTCAAGCTTGTTGCTAATTC
TATGTATGGTTGCTTGGGTTTCAGCTCTTCTCGTTTCTATGCTATGCCACTTGCATCCTT
CATTACAGCTAAAGGTATTTTATACAGTATTTGAACATAAAAATTTATACAAATTATTGA
TATTATAGGTAGACATATTCTATTTGATTCAAAGAAAATTGTAGAAGACATGGGCTATTC
TGTAATCTATGGTGACACAGATTCTTTGATGATAAAACCTGGCACAAATGAGTTCCTTGA
AGCAGTAAAAACAGGCTTAAGCATAAAAATAAAAGTCAACAGCAAATATAAGAAACTTTA
ATTAGACATTGATGGTGTGTTCAAAAATATGCTTTTACTCAAAAAGAAAAAATATGCTAC
TTTGAAGGTTGCAAACTGGGAAGAGGTAAAAAATACAAATGCTCCTGAAAAGTTAGAAAA
AGAAATTAAAGGTAATTTATTAAATAATATAAAGAATTAAAAATAAATACGGCTTAATAA
TATAATTAGGTATTGACGTTGTTCGTAGAGATTGGTGTTAATTATCCAGAGATGCTGGTA
ATAAAATCCTAGAAATTATATTAGAGAGCAAAAGCAGTGAAAATATGTTAGATGATATCA
AGAAATATTTGATTTAGCTGAGTAATTTAATAAAAATTTTGAAATTTATTCTATTTATTA
TAATTAATCTTTAAATTAATAAATAGATGATGACATAAATTAAAAGAACATTAAAAACAG
CAACTATTATATCACTAAGCGTTTGACTAAAAGAGTAGATTAATATGGTGAAAAGAACCT
TCCTCACGTAGCTGTTGCTCAAAGATCCATTTAAGAAAAAGGTATTGACCCTTAAACATA
CGTCAATCAAATTATCAGTTATATCATCTGCAAAAATGAATAATCTGTAAGCTTTCTTAG
TTAATTTTAATTCAAAAAATAAAATAAATAATATTTTTGGTCTCTAAGATTGTTAAATCT
AAATGAAGATTAGATATAAAAAATAAGTATCCTTTATAGAGTTTTTCTCTATAATAAATA
TATTTTTTAGAAATTATTTTTCGTTGATTCATGCATGGTTAATATTTAAAGAGAAAAGTG
GTGGTTATTGTAAATGCAAGAGAGGACAATTTATTACTAAATTCAAATAAAACATTTAGA
TAATATTTTATTAAAAATTATTATTTTGCTATTCTTGAAAAAAATAAAAATAAATAAAGC
TTTTTATTTAAATTTAACATTAAAAACACAATAAAATTGAACATTTTTATGATGCTAATT
TTAAAAATATTTCTTCAAAAAAAGCTAAAATTATAATGGAAAAATTTTTTATAACAATAA
ATAAACCTTTAAGAAGAAATTTTGTTTAAAAAATTGCTTAGAGACTAAAAGATATTTTTA
TTTTTATGAAATACTTTATTAATTTATTATTTAATTTAACAGAGCAGATTAGTAGATAAG
GCTTATAGTCCTTAAGAATTTATCACTTAAAGTAAAAGTTTGGAAATAGACTTATAATAC
TATAAGAGATTTTAACTTTTTGAACCAATAAAGAGAATGTTAGAAGTAATCGAGGGTATT
AATCTTTAAGAAATTGCAAGTATTCTTGAAGTTCACTACTCTGTCTAGCATGTTAGTTAG
TAAAAAAAACAAGATTAATTTATTATAATATTAACTTTTAATCTAAAATTAATTTAGAAA
TAATGAACTAAATGCTGAAAATGTACTTAACTTGAAGAGTAAAAGAAATCAATTTTTAAC
ATCTATTCCTCGTGTATTGGTAGATTGTAAGAAGTGTGATCAAACTTTCTTGTTTTTAGG
TATTCTTGAAGAAAATGCAGATGCTGCTTCGATTCTAAAATGCAAGTGTGGAAACGATAT
TTATATTTAACTTAAAAATAAAATAGCTCTTGTTGTTAAAGAGTTAATTAGAAATTTTGA
AGAAAATGCAATTCAAATTGATAATGAAGAATTTGAATATACTCACTAAATTTCTTTAGT
AGGAAAAGCCAAATAATAAAAAATGAGTAGCTTCACTTTGAACTAAAAGCTTCTTTCTAT
TCAAGCTATGTTTGATATCACAAAAGAGTAAATTTGAAAATAATTAGAAATAAGTAAATA
AATATATCATGAATTTTAATTTTATTTAATCAGGGAATAAGAAAATACTCAAAAGGTCAC
TATAGAAAAAATAAAAACAATTAAAGTAATTTATTTATTCAATATATTTTATTCATTAAT
TAATCTATTTTTATTTTAAAAGAAAACACTTGATGATTTATTGTCAAAATCTTAATACAA
TAATTTAAATTTAAGCAATATTTTTACAAGTTTCGGGTTATTAAAATGA