Identifiers and Description

Gene Model Identifier

TTHERM_01308010

Standard Name

POC1 (Proteome of centriole 1)

Aliases

PreTt02574 | 318.m00023

Description

POC1 POC1 centriolar-like protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00400 ) WD domain, G-beta repeat
  • ( TIGR01396 ) flagellar basal-body rod protein FlgB

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_01308010

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14508.19.997093137033517e-262POC1 centriolar protein (614 a
a)
OxytrichaContig20042.0.g313.000935899181433e-99WD domain, G-beta repeat
DictyBaseDDB_G02883759.9981864321491e-40lis1 on chromosome: 5 position
1452516 to 1453990
WormBaseWBGene000030473.9990760533890984e-36locus:lis-1 Lissencephaly-1
homolog status:Confirmed U
niProt:Q9NDC9 protein_id:CAB
03282.3
Stentor CoeruleusSteCoe_367241.3336148155022614e-34
SGDYBR198C9.99967697349061e-30TAF5 Subunit (90 kDa) of TFIID
and SAGA complexes, involved
in RNA polymerase II transcrip
tion initiation and in chromat
in modification

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:27251062: Meehl JB, Bayless BA, Giddings TH, Pearson CG, Winey M (2016) Tetrahymena Poc1 ensures proper intertriplet microtubule linkages to maintain basal body integrity. Molecular biology of the cell 27(15):2394-403
  2. Ref:20008567: Pearson CG, Osborn DP, Giddings TH, Beales PL, Winey M (2009) Basal body stability and ciliogenesis requires the conserved component Poc1. The Journal of cell biology 187(6):905-20

Sequences

>TTHERM_01308010(coding)
ATGAAGAAAACAACAATTGCATCATCAGCAGTAGCATCTCAAAAATAGACTTAAAGTAAA
CTTGGCAATACTTCTAGCAAAATTACTGAATAATAAACAACCCATGATCCAGCTTTGTCT
AGATCATTCAGAGGTCATGAAGATATCATTACTTGTGCTGATTTTGATCCTAAAATGCGC
CAAGTTGCATCTTGTTCTAAGGACTCTATTGTTTATGTTTGGAATTTTAAGCCATAGCAA
AGACCTTTTAAATTTGTAGGACATAAAGGAGCTGTTTATTGCGTAAAATACAGTCCTGAT
GGTGAAACAATTGCAAGTTGTGGCTAGGACAGATAGATCCGTCTTTGGTAGAATACAGTA
TAATCTAAATGCTCTATTATTAAGGCTCACTGCGGTGCTATTAGAAGTATGTCTTTCTCT
GCAGATGGTGGTTACTTGCTTTCTTCCTCTGATGATAAGACTTTAAAACTTTGGAGATTG
TAAGATAAGAAATTTATGTGCTCTTTTGCAGGACACAAAAACTGGGTTCGTTCTGGTGTC
ATTTCTCCAGACATGAGATTGGTTGCATCTGGCTCTGACGATAAGACAGTGATGCTATGG
GATTTGAATTTCTAAAAAATAGTTAGCAAATATAGTACTCTAGATGATAATGTTAAAATT
AGTTAAATTAACAGTTATAGTGATCACATGGATACAGTTAGTTAAGTTCTTTTCCATCCC
GATGGAACCTGCTTGATTTCTTCTTCCTTCGATCATAAAATTAAGATTACTGATATCCGT
TCAAATAAATTAATTTAACATTACAATGCTCATGATGCTTAAGTGAACAGCATTTCTATT
CATCCAACTGGTTATTTCCTTGCTTCTGCAGGCTCTGACTCTAAGATTAAAATTTGGGAT
CTCCGTTAAGGCAGACAAATCTACACTCTTTATTCCAATGATAAAGACATCACAACCGTA
TAATTCAATCAATCTGGTGACTACTTCGCTACTGGAGGATCTCAAAATCTTTGCATGGTT
TGGAAGACCAATTTTGATCAAAATATTCAAAATATCGAATAGGTTTAAAGATCTACAGTC
AGATAAAATGATGTTGAATACAGCAGTGGTGGATTGTATGCTTAGACACTTTTCAAGACA
AACAAAACTGCTTCTCTTTCTCCATCCAAAAAGACCATTTCTATAATTCCTCCTCAATAG
TTATAAGACACATTCAATAATAGAGGCGATGATGAATTAAATAACGGAAGAGTTCACGAA
AATAAATAATCAAATTCACCTACCTTCTCTTAATAATAATAATAACAATAACTCAATTTA
TCTGAAAATTAATATCCTGGACTTGAAATAGTTGGAAATCAATTCAATTTATAATAATCC
ACTCTTTCTAATAACAATAATCAAAACAATCTTATTAAATCTCAAAACGACTCTATTGTT
TCAAATAAAAACGCTATTCCTTTCCATCCTTCTTCTGAATTTTAACAATCTGCTGTTTAA
TAATAATTTTCCCAATAACCTAAATTAGTAGTAAACAACGGAACAGCAACTTATCCCTCG
AACTTCGTACCTAAAGTTGAAGAAGAAAATATTATGACTGAAGCCATAGCCGCAAGCATG
CAACAAATTTATAGCAGATTAGATACAATGTTCTAATATATGACAAACTTGGAAAACAGA
GTTGTCCAATCTGAATAATTACAAAAGAGTTTTGTGAGCTAAAACCACCAAAATACTTTA
GATCCTAAACAATAAACTATGAATTTTGGATATTCTAACATCCAAGACCATTCACTTTCT
GCAAGCTTAAACGACAGAAATGTAGTTAACATCTTCTAAGCCGGAGCTCTTGCAAACACT
GGATCAATTGAAGCTTCATTAATTAATAAGTAATAAGAAGAATGA


>TTHERM_01308010(protein)
MKKTTIASSAVASQKQTQSKLGNTSSKITEQQTTHDPALSRSFRGHEDIITCADFDPKMR
QVASCSKDSIVYVWNFKPQQRPFKFVGHKGAVYCVKYSPDGETIASCGQDRQIRLWQNTV
QSKCSIIKAHCGAIRSMSFSADGGYLLSSSDDKTLKLWRLQDKKFMCSFAGHKNWVRSGV
ISPDMRLVASGSDDKTVMLWDLNFQKIVSKYSTLDDNVKISQINSYSDHMDTVSQVLFHP
DGTCLISSSFDHKIKITDIRSNKLIQHYNAHDAQVNSISIHPTGYFLASAGSDSKIKIWD
LRQGRQIYTLYSNDKDITTVQFNQSGDYFATGGSQNLCMVWKTNFDQNIQNIEQVQRSTV
RQNDVEYSSGGLYAQTLFKTNKTASLSPSKKTISIIPPQQLQDTFNNRGDDELNNGRVHE
NKQSNSPTFSQQQQQQQLNLSENQYPGLEIVGNQFNLQQSTLSNNNNQNNLIKSQNDSIV
SNKNAIPFHPSSEFQQSAVQQQFSQQPKLVVNNGTATYPSNFVPKVEEENIMTEAIAASM
QQIYSRLDTMFQYMTNLENRVVQSEQLQKSFVSQNHQNTLDPKQQTMNFGYSNIQDHSLS
ASLNDRNVVNIFQAGALANTGSIEASLINKQQEE


>TTHERM_01308010(gene)
ATGAAGAAAACAACAATTGCATCATCAGCAGTAGCATCTCAAAAATAGACTTAAAGTAAA
CTTGGCAATACTTCTAGCAAAATTACTGAATAATAAACAACCCATGATCCAGCTTTGTCT
AGATCATTCAGAGGTCATGAAGATATCATTACTTGTGCTGATTTTGATCCTAAAATGTAA
TTTTTTATCAAAAAAGCTCAATTTATAAAATGAAAAATAATATAAAATCATTTTTTACAG
CTTTAAATCTGCTGTCAGATATTTTAGTAAAATTTTTTTTAATAATTAGGCGCCAAGTTG
CATCTTGTTCTAAGGACTCTATTGTTTATGTTTGGAATTTTAAGCCATAGCAAAGACCTT
TTAAATTTGTAGGACATAAAGGAGCTGTTTATTGCGTAAAATACAGTCCTGATGGTGAAA
CAATTGCAAGTTGTGGCTAGGACAGATAGATCCGTCTTTGGTAGAATACAGTGTAAATAA
GATATTTTGTTTTTTGAACAAATTTAGAATAATTCAGTTAAATAAATTCAAAAATAATTA
TGATGATAAGAATAAAAAATATATAACTTCAATCAAAAATAAAACCAGCTTTTATAAAAG
GAAAAATCATTAAAATGTTTTATAAATTCTAAAGCCTTTCAATAATTTGGTGAAGCAAAA
TGAAAACTAACTCGCAATTTAAATTTGAAAACTAAAGATTGTATTGATTTATTTAAATTT
TATTTTAAAAATAAAATAATGCTAAACTGAAAATCTAAGTGCAAATCAATAAGTTAAAAA
ATAAACCAACAACCCCAAAAAAGATTTGAATTTTTATAATTAATTGCTTTGACAAGCTAC
TGATAAATTTTAAATTTATTCGGTCAATATACTAAATTAATTTCAAAGTAGAGTAATAAA
TATATTTAATATCCAAAACAATCTGCAACTAAATTTCATATAACTAAATTTAATATATGT
ATGCTTAAACAATCTGAGCATTTATTTACAATCATATTAAGAGTGGATTTATTTCTTTAA
TAAACACTTGAAAATCCCTTCATTAAAATCAATATTTTTGTTTGAATTTTATTTAAGCAA
AAGTACAAGCAATATCTTAAATAAAACCTGAGAGTATATATAAAATATAAGCATCAAAAG
ATAAATTATAAATATAGAAATCTACTTAAGCAACAGGCAAGAATAGAAAATATAAATTTT
TTTGAAATAATTGTTAATGATTAAGTAAATTATCTGTTAACATAATTAACTTTTAAATAC
AACTTCTGCTCTAAAAATTTTAATATAATTGCCAAAGAAAATTATTACAAAGTAGTTTTA
AATGATTAAAATTATTTTTATCATCATCAAAAATGTTTGATCTCTTTGATTAATTTTTAG
AATTTATTTCTTTTATTTTCTAAGATCTAATTTTGATAATTATTAATTGATTTTTTAATA
AATTAGATAATCTAAATGCTCTATTATTAAGGCTCACTGCGGTGCTATTAGAAGTATGTC
TTTCTCTGCAGATGGTGGTTACTTGCTTTCTTCCTCTGATGATAAGACTTTAAAACTTTG
GAGATTGTAAGATAAGAAATTTATGTGCTCTTTTGCAGGACACAAAAACTGGGTTCGTTC
TGGTGTCATTTCTCCAGACATGAGATTGGTTGCATCTGGCTCTGACGATAAGACAGTGAT
GCTATGGGATTTGAATTTCTAAAAAATAGTTAGCAAATATAGTACTCTAGATGATAATGT
TAAAATTAGTTAAATTAACAGTTATAGTGATCACATGGATACAGTTAGTTAAGTTCTTTT
CCATCCCGATGGAACCTGCTTGATTTCTTCTTCCTTCGATCATAAAATTAAGATTACTGA
TATCCGTTCAAATAAATTAATTTAACATTACAATGCTCATGATGCTTAAGTGAACAGCAT
TTCTATTCATCCAACTGGTTATTTCCTTGCTTCTGCAGGCTCTGACTCTAAGATTAAAAT
TTGGGATCTCCGTTAAGGCAGACAAATCTACACTCTTTATTCCAATGATAAAGACATCAC
AACCGTATAATTCAATCAATCTGGTGACTACTTCGCTACTGGAGGATCTCAAAATCTTTG
CATGGTTTGGAAGACCAATTTTGATCAAAATATTCAAAGTAAAAAAATATTTTATTTTTA
TTGATAATAAGTTTTTATAGAGATTTTAATAGAATAAAAATACATTGATAAAAAGTTAAA
CAATATTATTTTAAATGAGATAATTTGAAAATCTGTCTTTAAAGTTTTTAGCAGCAATAA
AAGTTAAATTTTTTCTTATTTGTAGAAAAAACAAAAAAAAAATGAATTAACTTTGAAATA
TTTAAAATAAAATCACATATTTAAAAGCAAAAAATAGCATTTAAAGGAATTTTTAAAAAT
AAATTATGATAAAAAATATTTTTTAAAATTGAAATAAAATTAATAAATTTGAAACAATAA
AAGCTATTTCTTTCTTTTGGATTAAAATTAATTTTAAATATAATTTATAAAAGATATCGA
ATAGGTTTAAAGATCTACAGTCAGATAAAATGATGTTGAATACAGCAGTGGTGGATTGTA
TGCTTAGACACTTTTCAAGACAAACAAAACTGCTTCTCTTTCTCCATCCAAAAAGACCAT
TTCTATAATTCCTCCTCAATAGTTATAAGACACATTCAATAATAGAGGCGATGATGAATT
AAATAACGGAAGAGTTCACGAAAATAAATAATCAAATTCACCTACCTTCTCTTAATAATA
ATAATAACAATAACTCAATTTATCTGAAAATTAATATCCTGGACTTGAAATAGTTGGAAA
TCAATTCAATTTATAATAATCCACTCTTTCTAATAACAATAATCAAAACAATCTTATTAA
ATCTCAAAACGACTCTATTGTTTCAAATAAAAACGCTATTCCTTTCCATCCTTCTTCTGA
ATTTTAACAATCTGCTGTTTAATAATAATTTTCCCAATAACCTAAATTAGTAGTAAACAA
CGGAACAGCAACTTATCCCTCGAACTTCGTACCTAAAGTTGAAGAAGAAAATGTAATATT
TATATTATTATTTACTTGTTTTAATTTGTTCTTTAAACTAGATTATGACTGAAGCCATAG
CCGCAAGCATGCAACAAATTTATAGCAGATTAGATACAATGTTCTAATATATGACAAACT
TGGAAAACAGAGTTGTCCAATCTGAATAATTACAAAAGAGTTTTGTGAGCTAAAACCACC
AAAATACTTTAGATCCTAAACAATAAACTATGAATTTTGGATATTCTAACATCCAAGACC
ATTCACTTTCTGCAAGCTTAAACGACAGAAATGTAGTTAACATCTTCTAAGCCGGAGCTC
TTGCAAACACTGGATCAATTGAAGCTTCATTAATTAATAAGTAATAAGAAGAATGA